


| Basic Information | |
|---|---|
| Family ID | F105283 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 42 residues |
| Representative Sequence | FLALVLAAGIAWFPRGNGSIADAEREARALASEETARESPLS |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 91.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.00 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (14.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 37.14% β-sheet: 0.00% Coil/Unstructured: 62.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF03992 | ABM | 4.00 |
| PF14216 | DUF4326 | 3.00 |
| PF13884 | Peptidase_S74 | 2.00 |
| PF07883 | Cupin_2 | 2.00 |
| PF00710 | Asparaginase | 2.00 |
| PF10459 | Peptidase_S46 | 1.00 |
| PF00912 | Transgly | 1.00 |
| PF01145 | Band_7 | 1.00 |
| PF06736 | TMEM175 | 1.00 |
| PF02384 | N6_Mtase | 1.00 |
| PF01546 | Peptidase_M20 | 1.00 |
| PF00578 | AhpC-TSA | 1.00 |
| PF13476 | AAA_23 | 1.00 |
| PF13180 | PDZ_2 | 1.00 |
| PF00211 | Guanylate_cyc | 1.00 |
| PF02129 | Peptidase_S15 | 1.00 |
| PF03235 | DUF262 | 1.00 |
| PF01850 | PIN | 1.00 |
| PF02656 | DUF202 | 1.00 |
| PF02517 | Rce1-like | 1.00 |
| PF13751 | DDE_Tnp_1_6 | 1.00 |
| PF06172 | Cupin_5 | 1.00 |
| PF01914 | MarC | 1.00 |
| PF08241 | Methyltransf_11 | 1.00 |
| PF12697 | Abhydrolase_6 | 1.00 |
| PF07690 | MFS_1 | 1.00 |
| PF04014 | MazE_antitoxin | 1.00 |
| PF13343 | SBP_bac_6 | 1.00 |
| PF01425 | Amidase | 1.00 |
| PF03466 | LysR_substrate | 1.00 |
| PF14588 | YjgF_endoribonc | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0252 | L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D | Translation, ribosomal structure and biogenesis [J] | 4.00 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 1.00 |
| COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 1.00 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.00 |
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 1.00 |
| COG3542 | Predicted sugar epimerase, cupin superfamily | General function prediction only [R] | 1.00 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 1.00 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 1.00 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.00 % |
| Unclassified | root | N/A | 29.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16700143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1083 | Open in IMG/M |
| 2088090014|GPIPI_16881339 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
| 2170459005|F1BAP7Q02I7XAO | Not Available | 518 | Open in IMG/M |
| 2170459023|GZGNO2B01BZJPC | Not Available | 524 | Open in IMG/M |
| 3300000956|JGI10216J12902_109189295 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1074 | Open in IMG/M |
| 3300002128|JGI24036J26619_10037199 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10048041 | Not Available | 717 | Open in IMG/M |
| 3300004157|Ga0062590_101354531 | Not Available | 705 | Open in IMG/M |
| 3300004268|Ga0066398_10206779 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300004479|Ga0062595_101833918 | Not Available | 578 | Open in IMG/M |
| 3300004479|Ga0062595_102236007 | Not Available | 537 | Open in IMG/M |
| 3300005167|Ga0066672_10621287 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium 13_1_20CM_4_54_11 | 699 | Open in IMG/M |
| 3300005180|Ga0066685_10600475 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 757 | Open in IMG/M |
| 3300005186|Ga0066676_10458039 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300005294|Ga0065705_10061770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 991 | Open in IMG/M |
| 3300005294|Ga0065705_10455655 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300005295|Ga0065707_10502270 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 756 | Open in IMG/M |
| 3300005332|Ga0066388_100008808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7616 | Open in IMG/M |
| 3300005332|Ga0066388_100056853 | All Organisms → cellular organisms → Bacteria | 4095 | Open in IMG/M |
| 3300005332|Ga0066388_108232635 | Not Available | 520 | Open in IMG/M |
| 3300005439|Ga0070711_100921487 | Not Available | 746 | Open in IMG/M |
| 3300005440|Ga0070705_101615304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300005457|Ga0070662_100619703 | Not Available | 911 | Open in IMG/M |
| 3300005471|Ga0070698_100002406 | All Organisms → cellular organisms → Bacteria | 20606 | Open in IMG/M |
| 3300005471|Ga0070698_100011884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 9236 | Open in IMG/M |
| 3300005529|Ga0070741_11028536 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 704 | Open in IMG/M |
| 3300005540|Ga0066697_10743543 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 535 | Open in IMG/M |
| 3300005713|Ga0066905_101681538 | Not Available | 583 | Open in IMG/M |
| 3300005713|Ga0066905_101798899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300005764|Ga0066903_102265252 | Not Available | 1049 | Open in IMG/M |
| 3300005764|Ga0066903_103071978 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300005764|Ga0066903_107394378 | Not Available | 567 | Open in IMG/M |
| 3300005985|Ga0081539_10204912 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300005993|Ga0080027_10396963 | Not Available | 555 | Open in IMG/M |
| 3300006358|Ga0068871_100919146 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300006846|Ga0075430_100630227 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300006880|Ga0075429_101138212 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300006904|Ga0075424_100172772 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2293 | Open in IMG/M |
| 3300006954|Ga0079219_10058166 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Larkinella → Larkinella soli | 1704 | Open in IMG/M |
| 3300006954|Ga0079219_12063356 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 544 | Open in IMG/M |
| 3300006969|Ga0075419_10227408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1241 | Open in IMG/M |
| 3300006969|Ga0075419_10828494 | Not Available | 664 | Open in IMG/M |
| 3300009053|Ga0105095_10274389 | Not Available | 926 | Open in IMG/M |
| 3300009090|Ga0099827_11881287 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300009098|Ga0105245_12366869 | Not Available | 585 | Open in IMG/M |
| 3300009137|Ga0066709_102290802 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 741 | Open in IMG/M |
| 3300009147|Ga0114129_10081044 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 4511 | Open in IMG/M |
| 3300009147|Ga0114129_13100046 | Not Available | 543 | Open in IMG/M |
| 3300009156|Ga0111538_10718161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1266 | Open in IMG/M |
| 3300009156|Ga0111538_13844589 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
| 3300010046|Ga0126384_10084248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2300 | Open in IMG/M |
| 3300010046|Ga0126384_11550528 | Not Available | 622 | Open in IMG/M |
| 3300010046|Ga0126384_12397040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium GWA2_57_13 | 511 | Open in IMG/M |
| 3300010047|Ga0126382_11850593 | Not Available | 569 | Open in IMG/M |
| 3300010335|Ga0134063_10346114 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300010337|Ga0134062_10469937 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300010361|Ga0126378_11204321 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 855 | Open in IMG/M |
| 3300010361|Ga0126378_12390224 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 603 | Open in IMG/M |
| 3300010361|Ga0126378_12829689 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 554 | Open in IMG/M |
| 3300010366|Ga0126379_10172902 | All Organisms → cellular organisms → Bacteria | 2044 | Open in IMG/M |
| 3300010366|Ga0126379_13725991 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 511 | Open in IMG/M |
| 3300010375|Ga0105239_10951802 | Not Available | 986 | Open in IMG/M |
| 3300010376|Ga0126381_104761571 | Not Available | 522 | Open in IMG/M |
| 3300010398|Ga0126383_10159703 | All Organisms → cellular organisms → Bacteria | 2115 | Open in IMG/M |
| 3300010400|Ga0134122_13023387 | Not Available | 525 | Open in IMG/M |
| 3300012200|Ga0137382_10189155 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1411 | Open in IMG/M |
| 3300012202|Ga0137363_11645529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300012203|Ga0137399_11454403 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300012206|Ga0137380_10326264 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300012208|Ga0137376_11713393 | Not Available | 519 | Open in IMG/M |
| 3300012285|Ga0137370_10590938 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300012350|Ga0137372_10644259 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300012924|Ga0137413_10449498 | Not Available | 938 | Open in IMG/M |
| 3300012948|Ga0126375_11544138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300012951|Ga0164300_10243886 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300012958|Ga0164299_10960150 | Not Available | 626 | Open in IMG/M |
| 3300012971|Ga0126369_11035972 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300012971|Ga0126369_12930348 | Not Available | 559 | Open in IMG/M |
| 3300015374|Ga0132255_102112606 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300016387|Ga0182040_11079480 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 672 | Open in IMG/M |
| 3300018075|Ga0184632_10009521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4070 | Open in IMG/M |
| 3300020021|Ga0193726_1257014 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 704 | Open in IMG/M |
| 3300020062|Ga0193724_1077257 | Not Available | 692 | Open in IMG/M |
| 3300021411|Ga0193709_1083342 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 708 | Open in IMG/M |
| 3300022694|Ga0222623_10130826 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 978 | Open in IMG/M |
| 3300025915|Ga0207693_10388084 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300025933|Ga0207706_10927287 | Not Available | 735 | Open in IMG/M |
| 3300027654|Ga0209799_1167535 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 500 | Open in IMG/M |
| 3300028718|Ga0307307_10282819 | Not Available | 533 | Open in IMG/M |
| 3300028828|Ga0307312_10498484 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300031128|Ga0170823_15668020 | All Organisms → cellular organisms → Bacteria | 2413 | Open in IMG/M |
| 3300031239|Ga0265328_10045047 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1623 | Open in IMG/M |
| 3300031446|Ga0170820_13629501 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 628 | Open in IMG/M |
| 3300031573|Ga0310915_10370484 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300031682|Ga0318560_10688433 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300031771|Ga0318546_10797576 | All Organisms → cellular organisms → Bacteria → PVC group | 665 | Open in IMG/M |
| 3300031820|Ga0307473_10651468 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 734 | Open in IMG/M |
| 3300031962|Ga0307479_11393671 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 660 | Open in IMG/M |
| 3300033290|Ga0318519_10577069 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300033290|Ga0318519_10645845 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 1.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02888320 | 2088090014 | Soil | IVFLALVLAAGIAWFPRGXXXXXXXXREARALASEETAREGPLS |
| GPIPI_02229470 | 2088090014 | Soil | LAVVLAAGIAWFPRGSGSIADAXXXXXXLASEETARERPLS |
| E41_10335150 | 2170459005 | Grass Soil | LALVLAAGFAWFPRGKDAIADAEREEQALESEETAREGPL |
| FA3_10042350 | 2170459023 | Grass Soil | VFLALVLAAGIVWFPRGSGSIADAEREARALASEETTRESPLS |
| JGI10216J12902_1091892951 | 3300000956 | Soil | FLALVLAAGIGWFPRGSGSIADAEHEAQALASEETARESPLS* |
| JGI24036J26619_100371993 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | LVLAAGIAWFPRSKGSIADAEREARALASEETARESPLS* |
| JGIcombinedJ43975_100480411 | 3300002899 | Soil | LVLAAGIAWFPRGSGSIADAEREARALASKETARESPLS* |
| Ga0062590_1013545312 | 3300004157 | Soil | VFLALVLAAGIAWFPRGNGFIADAKREARALASEETARESPRS* |
| Ga0066398_102067791 | 3300004268 | Tropical Forest Soil | LLALVLAAGFAWFPRAKGSIADAERGAKALTSEETAREGSSL* |
| Ga0062595_1018339182 | 3300004479 | Soil | LATAIAFLAVVLAAGIVWFPRGSGSIAGAEREARALTSEETARENPLS* |
| Ga0062595_1022360071 | 3300004479 | Soil | MVFLALVLAAGIAWFPRGKGSMADAEHEARALASDETATESPLS* |
| Ga0066672_106212871 | 3300005167 | Soil | RFSLATAIVFLALVLAAGIAWFPRGSGSIAGAEREAQALASEETARESPLS* |
| Ga0066685_106004752 | 3300005180 | Soil | FLAVVLAAGIAWFPRGSGSIADAQREARALASEETARESPLS* |
| Ga0066676_104580392 | 3300005186 | Soil | FLAVVLAAGIAWFPRGSGSIADAQREARPLASEETARESPLS* |
| Ga0065705_100617701 | 3300005294 | Switchgrass Rhizosphere | AMVFLALVLAAGFAWFPRGKGAIADAEREAQAIASEETARESPLS* |
| Ga0065705_104556551 | 3300005294 | Switchgrass Rhizosphere | LALVLAAGFAWFPRGKGVIADAEREAQALESEEAAREGPL* |
| Ga0065707_105022701 | 3300005295 | Switchgrass Rhizosphere | LALVLAAGIAWFPRGSGSIADAEREARALVSEETARESPIS* |
| Ga0066388_1000088089 | 3300005332 | Tropical Forest Soil | MAMVFLALVLAAGFAWFPRGKGAIADAEREAQALESEESTREIPLS* |
| Ga0066388_1000568534 | 3300005332 | Tropical Forest Soil | AMVLLALVLAAGFAWFPRGKGAIADAEREASALESEETAREGPL* |
| Ga0066388_1082326351 | 3300005332 | Tropical Forest Soil | LALVLAAGFAWFPRGKGAIADAEREAQALESEETAREGPL* |
| Ga0070711_1009214872 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | TAIVFLALVLAAGIVWFPRGSGSIAGAEREARALASEETTRESPLS* |
| Ga0070705_1016153041 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | FSLATAMVFLALVLAAGFAWFPRGKGAIADAEREAQALESEETAREGPL* |
| Ga0070662_1006197031 | 3300005457 | Corn Rhizosphere | FLALVLAAGIVWFPLGSGSIADAEHEARALASEETTRESPLS* |
| Ga0070698_10000240625 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | ALVLAAGFAWFPRAKGSNADAERGAKALASEETARESHLSYD* |
| Ga0070698_1000118841 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | ALVLAAGFAWFPRAKGSNADAERGAKALASEETARESHL* |
| Ga0070741_110285361 | 3300005529 | Surface Soil | LAAGIAWFPRGRGSIAGAEREARTLASEEAASENPAG* |
| Ga0066697_107435431 | 3300005540 | Soil | AAGIVWFPRGSGSIADAEHEARTLASEETARESPLS* |
| Ga0066905_1016815383 | 3300005713 | Tropical Forest Soil | AAGFAWFPRGKGAIADAERGAKALESEETARESTL* |
| Ga0066905_1017988991 | 3300005713 | Tropical Forest Soil | TAILILALVLAAGYAWFPRGKGGLADARREARAVSSEEAIREPG* |
| Ga0066903_1022652521 | 3300005764 | Tropical Forest Soil | FLALVLAAGIAWFPRGRGSIADAQREARALTSEETARESPLS* |
| Ga0066903_1030719782 | 3300005764 | Tropical Forest Soil | VVLAAGILWFPRGRGSIADAEREARALTSEETARESPLS* |
| Ga0066903_1073943781 | 3300005764 | Tropical Forest Soil | AAGIVWFPRGKGSIVDAEREARALASEETVRESPLS* |
| Ga0081539_102049121 | 3300005985 | Tabebuia Heterophylla Rhizosphere | AAGIAWFPRGSGSIANAEREARALASEETARESPLS* |
| Ga0080027_103969631 | 3300005993 | Prmafrost Soil | VFLALVLAAGFAWFPRGKGSVADAEREARAIASEENAGLS* |
| Ga0068871_1009191461 | 3300006358 | Miscanthus Rhizosphere | SLATAIVFLAIVLAAGIAWFPRGEGSIAGAEREAQALASEETARESPLS* |
| Ga0075430_1006302271 | 3300006846 | Populus Rhizosphere | VKIEDRPTAAGFAWFPRGKGADAEREAEALESEETA |
| Ga0075429_1011382121 | 3300006880 | Populus Rhizosphere | ATAMVLLALVLAAGFVWFPRGKHSIADAEREARAVASEEAVRESLLRRE* |
| Ga0075424_1001727725 | 3300006904 | Populus Rhizosphere | FLALVLAAGIAWFPPGKSSIADAEREARALASDETARESPPS* |
| Ga0079219_100581663 | 3300006954 | Agricultural Soil | FLVLVLAAGIAWFPRGNGSIADAEREARALKSEETARNSSLS* |
| Ga0079219_120633562 | 3300006954 | Agricultural Soil | VLAAGIAWFPRGKGSMADAERQARALASEETARESPLS* |
| Ga0075419_102274082 | 3300006969 | Populus Rhizosphere | VKIEDRPTAAGFAWFPRGKGADAEREAEALESEETAREGPL* |
| Ga0075419_108284942 | 3300006969 | Populus Rhizosphere | VKIEDRPTAAGFAWFPRGKGAIADAEREEQALESEETAREGPL* |
| Ga0105095_102743893 | 3300009053 | Freshwater Sediment | LVLALVLAAGVAWFPKGRGGIADAAREASALESEEARRGSPEGAGIG* |
| Ga0099827_118812872 | 3300009090 | Vadose Zone Soil | FLALVLAAGIAWFPRGNGSIADAEREARALASEETARESPLS* |
| Ga0105245_123668691 | 3300009098 | Miscanthus Rhizosphere | VFLALVLAAGITWFPRGTGSIADAEREARALASEETARESPLS* |
| Ga0066709_1022908022 | 3300009137 | Grasslands Soil | AAGIVWFPRGSGSIAGAEREARTLASEETARESPLS* |
| Ga0114129_100810441 | 3300009147 | Populus Rhizosphere | LVLAAGIGWFPRGKRSIADAEREARALASEESARESPPS* |
| Ga0114129_131000462 | 3300009147 | Populus Rhizosphere | FLALVLAAGFAWFPRGKGAIADAEREAQALESEETAREGPL* |
| Ga0111538_107181611 | 3300009156 | Populus Rhizosphere | FLTLVLAAGFAWFPRGKGAIADAEREARALESEETAREGPL* |
| Ga0111538_138445892 | 3300009156 | Populus Rhizosphere | VFLVVVLAAGIAWFPRGSGSIADAEREARALASEETARESPLS* |
| Ga0126384_100842482 | 3300010046 | Tropical Forest Soil | MVLLALVLAAGFAWFPRGKGAIADAEREARALESEETAREGPL* |
| Ga0126384_115505282 | 3300010046 | Tropical Forest Soil | VLLTLVLAAGFAWFPRGKGSIVEAEREAQALTSEEAARESNLS* |
| Ga0126384_123970401 | 3300010046 | Tropical Forest Soil | LATAMVLLALVLASGFAWFPRGRGAITDAEREAQALESEEAAREGPL* |
| Ga0126382_118505931 | 3300010047 | Tropical Forest Soil | VLLALVLAAGFAWFPRGKGAITDAEREAQALESEEAAREGPL* |
| Ga0134063_103461142 | 3300010335 | Grasslands Soil | VLAAGIAWFPRGSGSIAGAEREAQALTSEETARESPLS* |
| Ga0134062_104699371 | 3300010337 | Grasslands Soil | AAGIAWFPRGSGSIAGAEREAQALTSEETARESPLS* |
| Ga0126378_112043211 | 3300010361 | Tropical Forest Soil | AIVLAGGIVWFPRGSGSIAGAEREARALASEETARESPPQNR* |
| Ga0126378_123902242 | 3300010361 | Tropical Forest Soil | AGFVWFPRGSGSIADAEREARALASEESARESPLS* |
| Ga0126378_128296892 | 3300010361 | Tropical Forest Soil | VFLAVVLAVGIAWFPRGSGSIADAKREARALASEETARESPLS* |
| Ga0126379_101729022 | 3300010366 | Tropical Forest Soil | MVFLALVLAGGIAWFPRGKGSVADAEREAHALAFEETTRETPLS* |
| Ga0126379_137259912 | 3300010366 | Tropical Forest Soil | AIAFLTVVLAAGILWFPRGRGSIAGAEREARSLASEETARESPLS* |
| Ga0105239_109518023 | 3300010375 | Corn Rhizosphere | TAGFTWFPRGKGSIVANAEREAQALASEETARESPLS* |
| Ga0126381_1047615711 | 3300010376 | Tropical Forest Soil | AGILWFPRGRGSIADAEREARALTSEETARESPLS* |
| Ga0126383_101597034 | 3300010398 | Tropical Forest Soil | LVLAAGFAWFPRGKGAIADAEREARALESEETAREGPL* |
| Ga0134122_130233872 | 3300010400 | Terrestrial Soil | IAFLAVVLAAGIAWFPRGSGSIAGAEREARALASEETARESPLS* |
| Ga0137382_101891553 | 3300012200 | Vadose Zone Soil | FSLATAIAFLAVVLAAGIVWFPRGSGSIADAQREARVLASEETARESPLS* |
| Ga0137363_116455291 | 3300012202 | Vadose Zone Soil | MVFLALVLAAGFAWFPRGKGAIADAEREEQALASEETAREGPL* |
| Ga0137399_114544032 | 3300012203 | Vadose Zone Soil | LAVVLAAGIAWFPRGSGSIANAEREAQALASEETARESPLS* |
| Ga0137380_103262643 | 3300012206 | Vadose Zone Soil | ATAIVFLGLVLAAGIVWFPRGKGSIADAEHEAKALASDETARESPLS* |
| Ga0137376_117133932 | 3300012208 | Vadose Zone Soil | FLAVVLAAGIAWFPRGSGSIANAEREARALASEETAPESPLS* |
| Ga0137370_105909381 | 3300012285 | Vadose Zone Soil | VVLAAGIAWFPRGSGSITNAKREARALASEETAPESPLS* |
| Ga0137372_106442591 | 3300012350 | Vadose Zone Soil | TAIVFLALVLAAGIAWFPRGNGSIADAEREARALASEETARESPLS* |
| Ga0137413_104494982 | 3300012924 | Vadose Zone Soil | VTAIAFLAVVLAAGIAWFPRGSGSIADAQREARALASEETARESPLS* |
| Ga0126375_115441381 | 3300012948 | Tropical Forest Soil | IVFLALVLAAGFAWFPRGKGSIADAEREARELASEETARESPLS* |
| Ga0164300_102438861 | 3300012951 | Soil | LALILAAGIAWFPRGKGSMADAEHEARALASEETARETPLS* |
| Ga0164299_109601501 | 3300012958 | Soil | LVLAAGIAWFPRGNGSLADAEREARALGSEETARESPRS* |
| Ga0126369_110359722 | 3300012971 | Tropical Forest Soil | VVLAAGIVWFPRGSGSIAGAEREARALASEETAHENPLS* |
| Ga0126369_129303481 | 3300012971 | Tropical Forest Soil | FSLATAIVFLGLVLAAGIAWFPRGKGSMADAEHEARALASEETARETPLS* |
| Ga0132255_1021126063 | 3300015374 | Arabidopsis Rhizosphere | MVFLTLVLAAGFVWFPRGKGAIADAEREEQALESEETAREGPL* |
| Ga0182040_110794801 | 3300016387 | Soil | LATAIVFLGLVLAAGILWFPRGGGSIIGAEREARALASEETARESPLS |
| Ga0184632_100095213 | 3300018075 | Groundwater Sediment | FSLATAMVFLALVLAAGFAWFPRGKGAIADAEREARALASETAREGPL |
| Ga0193726_12570141 | 3300020021 | Soil | VLAAGIAWFPRGSGSIADAEREARTLASEETARESPLS |
| Ga0193724_10772572 | 3300020062 | Soil | ATAIVFLTIVLAAGMVWFPRGSGSIADAEREARALASEETARESPLS |
| Ga0193709_10833422 | 3300021411 | Soil | FLAVVLAAGIAWFPRGSGSIADAQREARALASEETARESPLS |
| Ga0222623_101308262 | 3300022694 | Groundwater Sediment | FLAVVLAAGIAWFPRGSGSIANAEREARALASEETARESPLS |
| Ga0207693_103880842 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MVFLALVLAAGFAWFPRGKGAIADAEREAQALESEETAREGPL |
| Ga0207706_109272871 | 3300025933 | Corn Rhizosphere | LAAGIVWFPLGSGSIADAEHEARALASEETTRESPLS |
| Ga0209799_11675352 | 3300027654 | Tropical Forest Soil | LLALVLAAGFAWFPRAKGSIADAERGAKALTSEETAREGSSL |
| Ga0307307_102828191 | 3300028718 | Soil | VLAAGMVWFPRGSGSIADAEREARTLESEETASESPLS |
| Ga0307312_104984841 | 3300028828 | Soil | LATAIVFLAVVLAAGIVWFPRGSGSIADAEREARTLESEETASESPLS |
| Ga0170823_156680204 | 3300031128 | Forest Soil | FLAVVLAAGIAWFPRGSGSIADAEREAQTLASEETARESPLS |
| Ga0265328_100450471 | 3300031239 | Rhizosphere | VVLLCLVLAAGLKWFPRGKGGIADATREQKSLESEESSRAGPESAGLG |
| Ga0170820_136295011 | 3300031446 | Forest Soil | AIGFLALVLAAGIAWFPRGSGSIADAESEARALASEETARESPLS |
| Ga0310915_103704843 | 3300031573 | Soil | LVLAAGIAWFPRGKSSIADAEREARALASDETARESPPS |
| Ga0318560_106884332 | 3300031682 | Soil | IVFLAIVLAAGIAWFPRGSGSITDAKCEARALASEETARESPLS |
| Ga0318546_107975761 | 3300031771 | Soil | LTLVLAAGITWFPRGKGSMADAEHEARALTSDETARENPLS |
| Ga0307473_106514681 | 3300031820 | Hardwood Forest Soil | ATAILFLTVVLVAGIAWFPRGSGSIADAESEARALASEETARESPLS |
| Ga0307479_113936711 | 3300031962 | Hardwood Forest Soil | LAVVLAAGIAWFPRGSGSIADAEREARALVSEETARESPLS |
| Ga0318519_105770693 | 3300033290 | Soil | AAGIAWFPRGSGSITDAKCEARALASEETARESPLS |
| Ga0318519_106458451 | 3300033290 | Soil | AIVFLAVVLAAGIAWFPRGSGSIAGAEREAQALASEETARESPLS |
| ⦗Top⦘ |