NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105272

Metagenome / Metatranscriptome Family F105272

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105272
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 38 residues
Representative Sequence GLVVSQLITLYLTPVVYTYMAGLFKTRKIRGTVAKPATA
Number of Associated Samples 87
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.00 %
% of genes near scaffold ends (potentially truncated) 95.00 %
% of genes from short scaffolds (< 2000 bps) 96.00 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(8.000 % of family members)
Environment Ontology (ENVO) Unclassified
(41.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(44.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 35.82%    β-sheet: 0.00%    Coil/Unstructured: 64.18%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF00873ACR_tran 78.00
PF07883Cupin_2 2.00
PF00754F5_F8_type_C 1.00
PF01161PBP 1.00
PF07992Pyr_redox_2 1.00
PF01266DAO 1.00
PF05698Trigger_C 1.00
PF01979Amidohydro_1 1.00
PF13667ThiC-associated 1.00
PF01370Epimerase 1.00
PF07228SpoIIE 1.00
PF11790Glyco_hydro_cc 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0544FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor)Posttranslational modification, protein turnover, chaperones [O] 1.00
COG1881Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) familyGeneral function prediction only [R] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.00 %
UnclassifiedrootN/A9.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908032|Perma_A_C_ConsensusfromContig36850All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales959Open in IMG/M
3300001686|C688J18823_10145739All Organisms → cellular organisms → Bacteria1626Open in IMG/M
3300005180|Ga0066685_10149317All Organisms → cellular organisms → Bacteria1589Open in IMG/M
3300005364|Ga0070673_102122898All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300005542|Ga0070732_10881274All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300005543|Ga0070672_101166323All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300005575|Ga0066702_10654487All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300005616|Ga0068852_102127029Not Available583Open in IMG/M
3300005719|Ga0068861_100107729All Organisms → cellular organisms → Bacteria → Acidobacteria2228Open in IMG/M
3300005764|Ga0066903_100869327All Organisms → cellular organisms → Bacteria → Acidobacteria1626Open in IMG/M
3300005764|Ga0066903_102557898All Organisms → cellular organisms → Bacteria → Acidobacteria989Open in IMG/M
3300005764|Ga0066903_105416516All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300005764|Ga0066903_107830194All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005764|Ga0066903_108547948All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus522Open in IMG/M
3300005843|Ga0068860_100529118All Organisms → cellular organisms → Bacteria1179Open in IMG/M
3300005843|Ga0068860_101003260All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus853Open in IMG/M
3300005844|Ga0068862_100347827All Organisms → cellular organisms → Bacteria1375Open in IMG/M
3300006031|Ga0066651_10160646All Organisms → cellular organisms → Bacteria → Acidobacteria1181Open in IMG/M
3300006358|Ga0068871_101397334All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300006854|Ga0075425_101317329All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus818Open in IMG/M
3300006871|Ga0075434_101565101All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300006880|Ga0075429_100455527All Organisms → cellular organisms → Bacteria → Acidobacteria1121Open in IMG/M
3300006953|Ga0074063_13718705All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus527Open in IMG/M
3300006969|Ga0075419_11399642All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300009011|Ga0105251_10147557All Organisms → cellular organisms → Bacteria → Acidobacteria1063Open in IMG/M
3300009137|Ga0066709_100193002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Dongia → unclassified Dongia → Dongia sp. URHE00602665Open in IMG/M
3300009137|Ga0066709_102703313All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300009162|Ga0075423_10417806All Organisms → cellular organisms → Bacteria → Acidobacteria1408Open in IMG/M
3300009176|Ga0105242_10819166Not Available923Open in IMG/M
3300009177|Ga0105248_11447757All Organisms → cellular organisms → Bacteria → Acidobacteria777Open in IMG/M
3300009551|Ga0105238_12896815Not Available516Open in IMG/M
3300009661|Ga0105858_1080220All Organisms → cellular organisms → Bacteria → Acidobacteria858Open in IMG/M
3300010329|Ga0134111_10137294All Organisms → cellular organisms → Bacteria → Acidobacteria961Open in IMG/M
3300010358|Ga0126370_12476214All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300010359|Ga0126376_11291659All Organisms → cellular organisms → Bacteria → Acidobacteria749Open in IMG/M
3300010364|Ga0134066_10161403All Organisms → cellular organisms → Bacteria → Acidobacteria713Open in IMG/M
3300010376|Ga0126381_100427409All Organisms → cellular organisms → Bacteria1852Open in IMG/M
3300010376|Ga0126381_100567932All Organisms → cellular organisms → Bacteria → Acidobacteria1610Open in IMG/M
3300010379|Ga0136449_102790856All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300010398|Ga0126383_12878376All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300012096|Ga0137389_10834412All Organisms → cellular organisms → Bacteria → Acidobacteria791Open in IMG/M
3300012189|Ga0137388_10671496All Organisms → cellular organisms → Bacteria → Acidobacteria963Open in IMG/M
3300012199|Ga0137383_11052069All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300012201|Ga0137365_10079140All Organisms → cellular organisms → Bacteria → Acidobacteria2478Open in IMG/M
3300012357|Ga0137384_11172022All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300012948|Ga0126375_11778174All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300012951|Ga0164300_10743784All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300012971|Ga0126369_12049686Not Available660Open in IMG/M
3300012971|Ga0126369_12332335All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300012989|Ga0164305_10745127All Organisms → cellular organisms → Bacteria → Acidobacteria806Open in IMG/M
3300013297|Ga0157378_10742238All Organisms → cellular organisms → Bacteria → Acidobacteria1004Open in IMG/M
3300013307|Ga0157372_11775104All Organisms → cellular organisms → Bacteria → Acidobacteria709Open in IMG/M
3300014968|Ga0157379_11038549All Organisms → cellular organisms → Bacteria → Acidobacteria783Open in IMG/M
3300014968|Ga0157379_12356884All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300014968|Ga0157379_12399951All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300015373|Ga0132257_100828872All Organisms → cellular organisms → Bacteria → Acidobacteria1156Open in IMG/M
3300017659|Ga0134083_10307499All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300017947|Ga0187785_10080801All Organisms → cellular organisms → Bacteria → Acidobacteria1270Open in IMG/M
3300018000|Ga0184604_10280142All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300018029|Ga0187787_10220971All Organisms → cellular organisms → Bacteria → Acidobacteria678Open in IMG/M
3300018433|Ga0066667_10410459All Organisms → cellular organisms → Bacteria → Acidobacteria1097Open in IMG/M
3300019356|Ga0173481_10271109All Organisms → cellular organisms → Bacteria → Acidobacteria775Open in IMG/M
3300021363|Ga0193699_10254984All Organisms → cellular organisms → Bacteria → Acidobacteria731Open in IMG/M
3300021479|Ga0210410_10647914All Organisms → cellular organisms → Bacteria → Acidobacteria936Open in IMG/M
3300022532|Ga0242655_10281974All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300022756|Ga0222622_11303911All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300025321|Ga0207656_10132252All Organisms → cellular organisms → Bacteria → Acidobacteria1170Open in IMG/M
3300025899|Ga0207642_10422098All Organisms → cellular organisms → Bacteria → Acidobacteria802Open in IMG/M
3300025908|Ga0207643_10752375All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300025920|Ga0207649_10393821All Organisms → cellular organisms → Bacteria → Acidobacteria1035Open in IMG/M
3300025921|Ga0207652_11526340All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300025926|Ga0207659_10655255All Organisms → cellular organisms → Bacteria → Acidobacteria897Open in IMG/M
3300025927|Ga0207687_11098933All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300025927|Ga0207687_11152219All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300025933|Ga0207706_10952058All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300025940|Ga0207691_10243040All Organisms → cellular organisms → Bacteria1556Open in IMG/M
3300025941|Ga0207711_11286764All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300025942|Ga0207689_11667541All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300026041|Ga0207639_10966610All Organisms → cellular organisms → Bacteria → Acidobacteria797Open in IMG/M
3300026041|Ga0207639_12251139All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300026095|Ga0207676_11153603Not Available767Open in IMG/M
3300026142|Ga0207698_10762092Not Available967Open in IMG/M
3300027842|Ga0209580_10529934All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300028784|Ga0307282_10548291All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300028875|Ga0307289_10425940All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300029636|Ga0222749_10368801All Organisms → cellular organisms → Bacteria → Acidobacteria755Open in IMG/M
3300031232|Ga0302323_101547055All Organisms → cellular organisms → Bacteria → Acidobacteria748Open in IMG/M
3300031748|Ga0318492_10218855Not Available978Open in IMG/M
3300031894|Ga0318522_10279529Not Available633Open in IMG/M
3300031902|Ga0302322_103335229All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300031908|Ga0310900_11145950All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300031947|Ga0310909_10723710All Organisms → cellular organisms → Bacteria → Acidobacteria826Open in IMG/M
3300031996|Ga0308176_11341973All Organisms → cellular organisms → Bacteria → Acidobacteria760Open in IMG/M
3300032001|Ga0306922_11430138All Organisms → cellular organisms → Bacteria → Acidobacteria694Open in IMG/M
3300032051|Ga0318532_10228286Not Available661Open in IMG/M
3300032160|Ga0311301_10242522All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2990Open in IMG/M
3300032160|Ga0311301_12414935All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300032829|Ga0335070_10535299All Organisms → cellular organisms → Bacteria → Acidobacteria1107Open in IMG/M
3300033412|Ga0310810_10572519All Organisms → cellular organisms → Bacteria → Acidobacteria1095Open in IMG/M
3300034268|Ga0372943_0441899All Organisms → cellular organisms → Bacteria → Acidobacteria843Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.00%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.00%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.00%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908032Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_allEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009661Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Perma_A_C_036759202124908032SoilVGGLVVSQIITLYLTPVVYTYMAQVLKTRKIPNVATRPATA
C688J18823_1014573913300001686SoilSQLITLYLTPVVYTYMAGLFKTRRIRATVANPATA*
Ga0066685_1014931723300005180SoilVGGLVVSQLITLYLTPVVYTYMATLFKTRKIPDTSPVMA*
Ga0070673_10212289813300005364Switchgrass RhizosphereGGLVVSQLITLYLTPVVYTFFGGLVKTRRIEGPAAASTPATA*
Ga0070732_1088127423300005542Surface SoilVSQLITLYLTPVVYTYMAAIFSTSRRVGTVGAVSIAG*
Ga0070672_10116632323300005543Miscanthus RhizosphereSQLITLYLTPVVYTFFGSLVKTRQIVGAAPASKPATA*
Ga0066702_1065448723300005575SoilQLITLYLTPVVYTYMAGMFKTRTIRGTVPKPVTV*
Ga0068852_10212702923300005616Corn RhizosphereQLITLYLTPVVYTYMAGLVKTRRIPMSVAAKPRPA*
Ga0068861_10010772953300005719Switchgrass RhizosphereGLVVSQFITLYLTPVIYTYMAALVKTREIPAGATTKPATA*
Ga0066903_10086932723300005764Tropical Forest SoilITLYLTPVVYTYMATLVKTRKIEKVPGAAPSLAN*
Ga0066903_10255789823300005764Tropical Forest SoilGLVVSQLITLYLTPVVYTYLASWVKTRQIPVSAVSKPATA*
Ga0066903_10541651623300005764Tropical Forest SoilAVVGGLMVSQLITLYLTPVIYTYMAGMFKTRKIPQVAASQA*
Ga0066903_10783019413300005764Tropical Forest SoilQFITLYLTPVVYTYMAQLIATRRIPSTLSARPASA*
Ga0066903_10854794823300005764Tropical Forest SoilSQLITLYLTPVVYTYMAGLFKTRKIRGTVTKPVTA*
Ga0068860_10052911833300005843Switchgrass RhizosphereVVGGLMVSQLVTLYLTPVVYTYMAALVKTRPIPAGIVTRPATA*
Ga0068860_10100326013300005843Switchgrass RhizosphereVSQLITLYLTPVVYTYLAGMFKTRKIAMTKPVTA*
Ga0068862_10034782723300005844Switchgrass RhizosphereAVVGGLIVSQLITLYLTPVVYTYMAGMFKTSKIHGAVAAKPATA*
Ga0066651_1016064613300006031SoilQLITLYLTPVVYTYMAGMFKTRKIPVTRPVTAQTIG*
Ga0068871_10139733423300006358Miscanthus RhizosphereITLYLTPVVYTYMATLVKTRRIPATASTEPLTAQG*
Ga0075425_10131732913300006854Populus RhizosphereSQLITLYLTPVVYTYMATMFKTRKIPQTAAKPATA*
Ga0075434_10156510113300006871Populus RhizosphereGGLLVSQLITLYLTPVVYTYMATLFKTRKIREAVPA*
Ga0075429_10045552723300006880Populus RhizosphereLITLYLTPVVYTYLAGLVKTRRIAAVSTATPATAHS*
Ga0074063_1371870513300006953SoilSQLITLYLTPVVYTYLASIFKTRKIPVTATSPATA*
Ga0075419_1139964223300006969Populus RhizosphereGLLVSQLITLYLTPVVYTYLGGLVKTRRIAPSTASPDPATA*
Ga0105251_1014755723300009011Switchgrass RhizosphereVVSQLITLYLTPVVYTYMAGMFKTRKIREAVAKPVTA*
Ga0066709_10019300253300009137Grasslands SoilLLVSQLITLYLTPVIYTCLASAVKTRRIESPRPEPVTV*
Ga0066709_10270331323300009137Grasslands SoilGGLLVSQLITLYLTPVVYTYMASSFKTRKIPVTAPSRA*
Ga0075423_1041780623300009162Populus RhizosphereVSQLITLYLTPVIYTYMATMFKTSTIPKTVMANG*
Ga0105242_1081916623300009176Miscanthus RhizosphereLITLYLTPVVYTYLASIFKTRKIPVTATTNPATA*
Ga0105248_1144775723300009177Switchgrass RhizosphereGLLVSQLITLYLTPVVYTYMAAMFKTSKIPVTVATKPATA*
Ga0105238_1289681523300009551Corn RhizosphereQLITLYLTPVVYTYMAGMFKTSKIHGAVAAKPATA*
Ga0105858_108022013300009661Permafrost SoilVSQLITLYLTPVIYTYMAALVKTRKIPATVVIKPATA*
Ga0134111_1013729413300010329Grasslands SoilITLYLTPVVYTYMAGMFKTRKIPVTRPVTAQTIG*
Ga0126370_1247621413300010358Tropical Forest SoilVVGGLMVSQLITLYLTPVVYTYLATIFKTRQIPETVATTS*
Ga0126376_1129165923300010359Tropical Forest SoilVITLYLTPVVYTFMATWVKTRKIPAVAGEPIVSEQ*
Ga0134066_1016140323300010364Grasslands SoilVVGGLVVSQLITLYLTPVVYTYMATLFKTRKIPVTKPVTA*
Ga0126381_10042740933300010376Tropical Forest SoilGGLIVSQLITLYLTPVVYTYMASLVKTRRISAGLESKPATA*
Ga0126381_10056793223300010376Tropical Forest SoilGGLMVSQLITLYLTPVVYTYLATIFKTRQIPETAATTS*
Ga0136449_10279085613300010379Peatlands SoilVSQFITLYLTPVVYTYLATAVRTRRIAEPIAANPATA*
Ga0126383_1287837623300010398Tropical Forest SoilVVGGLVVSQLITLYLTPVVYTYMATLFKTRKIPQTATKPVTA*
Ga0137389_1083441213300012096Vadose Zone SoilVSQLITLYLTPVVYTYMAGMFKTRRIREVVTKPATA*
Ga0137388_1067149623300012189Vadose Zone SoilLVVSQLITLYLTPVVYTYMAGMFKTRKIPVTKTVTA*
Ga0137383_1105206923300012199Vadose Zone SoilAVVGGLLVSQLITLYLTPVVYTYMAMMFKTRRIPDTSPITA*
Ga0137365_1007914023300012201Vadose Zone SoilGLVVSQLITLYLTPVVYTYMAAMFKTRRIPQTATA*
Ga0137384_1117202213300012357Vadose Zone SoilGGLMISQLITLYLTPVVYTYMAQLFKTRKIPDVSSNPATA*
Ga0126375_1177817433300012948Tropical Forest SoilSQLITLYLTPVVYTYLAAIFKTRKVAPSIATKPVTA*
Ga0164300_1074378413300012951SoilLVSQLITLYLTPVVYVYLARLVKTRKISDVAVPRPATA*
Ga0126369_1204968623300012971Tropical Forest SoilSQLITLYLTPVVYTYFAALVRTRPIAMTLTESRSPAH*
Ga0126369_1233233523300012971Tropical Forest SoilVVGGLVVSQLITLYLTPVIYTYMAALVKTRRVPA*
Ga0164305_1074512723300012989SoilLVVSQLITLYLTPVVYTYMAAMFKTRRIPQTVTAS*
Ga0157378_1074223813300013297Miscanthus RhizosphereQLITLYLTPVVYTYMAGLFKTRKIRGTVADPATA*
Ga0157372_1177510413300013307Corn RhizosphereLLVSQLITLYLTPVVYVYLARMVKTRKISDVVVPRPATA*
Ga0157379_1103854923300014968Switchgrass RhizosphereGGLVVSQLITLYLTPVVYTFFGSLVKTRQIVSAAPASKPATA*
Ga0157379_1235688423300014968Switchgrass RhizosphereVSQLITLYLTPVVYTYLARLVKTRKISDVAVPRPATA*
Ga0157379_1239995123300014968Switchgrass RhizosphereIGGLMISQLITLYLTPVVYTYLASIFKTRKIPATATTTPATA*
Ga0132257_10082887223300015373Arabidopsis RhizosphereSQLITLYLTPVVYTYLGGLVKTRRIAPTTASPNPATA*
Ga0134083_1030749913300017659Grasslands SoilLVSQLITLYLTPVVYTYMAAIVKTRRIPATRPATA
Ga0187785_1008080123300017947Tropical PeatlandIVSQLLTLYLTPVVYTYMAKVFKTSRIAATEPVTA
Ga0184604_1028014223300018000Groundwater SedimentGGLVVSQLITLYLTPVVYTYMAGLFKTSKIRGAVAKPVTA
Ga0187787_1022097113300018029Tropical PeatlandSQLITLYLTTVVYTYMAQIMRTRKIPATVSTPAHA
Ga0066667_1041045923300018433Grasslands SoilGGLLVSQLITLYLTPVIYTYMASIFKTRKILAIETKPAVG
Ga0173481_1027110923300019356SoilITLYLTPVIYTYLGGIERRWKTRRIAPRGTASTNPATA
Ga0193699_1025498423300021363SoilITLYLTPVVYTYMATWVKTRKIPATSTAPIAATPTTA
Ga0210410_1064791413300021479SoilLITLYLTPVLYIYLASIVKTRHFTATSQAGTVPAVS
Ga0242655_1028197413300022532SoilGGLMVSQLITLYLTPVIYTYLASIFKTRKIPSTVTARPATA
Ga0222622_1130391123300022756Groundwater SedimentGLIVSQLITLYLTPVVYTYLAGLFKTSKIRGAVAKPVTA
Ga0207656_1013225213300025321Corn RhizosphereLISQLITLYLTPVVYTYLGGLVKTRRIAPTTASPNPATA
Ga0207642_1042209823300025899Miscanthus RhizosphereGGLLVSQLITLYLTPVVYTYLGGLVRTRKIAPGAASPDPSPA
Ga0207643_1075237513300025908Miscanthus RhizosphereVGGLMVSQLITLYLTPVVYTYMASMFKTSKIAPTVAPKPATA
Ga0207649_1039382113300025920Corn RhizosphereSQLITLYLTPVVYTYLGGLVRTRKIAPGAASPDPSPA
Ga0207652_1152634023300025921Corn RhizosphereLVVSQLITLYLTPVVYTYLAGLVKTRRIPALTHPAPAT
Ga0207659_1065525513300025926Miscanthus RhizosphereVGGLVVSQLITLYLTPVVYTYMAAMFKTRRIPQTATA
Ga0207687_1109893313300025927Miscanthus RhizosphereGGLVVSQLITLYLTPVVYTYMAGLFKTRGIRGAVAKPATA
Ga0207687_1115221913300025927Miscanthus RhizosphereGGLVVSQLITLYLTPVVYTYMAGLFKTRKIRGTVADPATA
Ga0207706_1095205813300025933Corn RhizosphereGGLIVSQLITLYLTPVVYTYMAGLFKTSKIRGTVVKPVTA
Ga0207691_1024304033300025940Miscanthus RhizosphereMRANPIGAPGGGLMVSQLITLYLTPVVYTYMAAIMKTRPIAAPVSSDPATA
Ga0207711_1128676413300025941Switchgrass RhizosphereGGLMISQLITLYLTPVVYTYLASIFKTRKIPVTATTNPATA
Ga0207689_1166754113300025942Miscanthus RhizosphereIGGLMISQLITLYLTPVVYTYLASIFKTRKIPATATTTPATA
Ga0207639_1096661023300026041Corn RhizosphereLIVSQLITLYLTPVVYTYMATMFKTRRIPQTAVAAAARS
Ga0207639_1225113923300026041Corn RhizosphereGGLIGSQRITLYLTPVVYTYMATMFKTRKIPQTAAKPATA
Ga0207676_1115360323300026095Switchgrass RhizosphereGGLLVSQLITLYLTPVIYSYFGQLVKTRRIAPASSPRPATA
Ga0207698_1076209223300026142Corn RhizosphereLVSQLITLYLTPVVYTYLATLVRTRHIPATSAHPAPAQS
Ga0209580_1052993413300027842Surface SoilVSQLITLYLTPVVYTYMAGLFKTRKIPQIAVVSEA
Ga0307282_1054829123300028784SoilGGLIVSQLITLYLTPVVYTYMAGLFKTSRIRGAVAAKPVSA
Ga0307289_1042594013300028875SoilVSQLITLYLTPVIYTYMAGLFKTSKIRGAVAAKPATA
Ga0222749_1036880123300029636SoilVGGLVVSQVITLYLTPVVYTYMAALLKTRKIPPTAIAKPATA
Ga0302323_10154705513300031232FenVVSQLITLYLTPVVYTYMAALVKTRKLATSASPRPATT
Ga0318492_1021885523300031748SoilVVSQLITLYLTPVVYTYMATWVKTRRITTSAATKPATA
Ga0318522_1027952923300031894SoilQLITLYLTPVVYTYMATWVKTRRITTSAATKPATA
Ga0302322_10333522913300031902FenLYLTPVVYTFMATWVKTRKIAVISATPATVTSAEA
Ga0310900_1114595013300031908SoilGGLLVSQLITLYLTPVVYTYLAQMFKTRRIPEIKPATA
Ga0310909_1072371023300031947SoilGLVVSQLITLYLTPVVYTYMAGLFKTRKIRGTVAKPATA
Ga0308176_1134197323300031996SoilVIGGLMISQLITLYLTPVVYTYLASIFKTRKIPSTATRPATA
Ga0306922_1143013813300032001SoilGLVVSQLITLYLTPVVYTYLATFVKTSRIPGELATSPQHP
Ga0318532_1022828623300032051SoilSQLITLYLTPVVYTYMATWVKTRRITTSAATKPATA
Ga0311301_1024252263300032160Peatlands SoilLVVSQLITLYLTPVVYTYLARVVKTRKLLTPASSAT
Ga0311301_1241493513300032160Peatlands SoilVSQFITLYLTPVVYTYLATAVRTRRIAEPIAANPATA
Ga0335070_1053529913300032829SoilVGGLIVSQVITLYLNPVVYTYMATWVKTSRIRTAGAVATTE
Ga0310810_1057251923300033412SoilGLVVSQVITLYLTPVVYTYMATWIKTRKIPVTAATTAPPATATPTTA
Ga0372943_0441899_4_1173300034268SoilVSQLITLYLTPVVYTYMAGLFKTRRIRGAVATNPATA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.