NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105119

Metagenome / Metatranscriptome Family F105119

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105119
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 43 residues
Representative Sequence MSAVAVPARAQRRNVLASVWAFVRRHVLTVYSILFFAYLLLPI
Number of Associated Samples 91
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 96.00 %
% of genes near scaffold ends (potentially truncated) 97.00 %
% of genes from short scaffolds (< 2000 bps) 88.00 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (58.000 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(24.000 % of family members)
Environment Ontology (ENVO) Unclassified
(35.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 46.48%    β-sheet: 0.00%    Coil/Unstructured: 53.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF00528BPD_transp_1 86.00
PF08402TOBE_2 4.00
PF13416SBP_bac_8 3.00
PF13343SBP_bac_6 2.00
PF13347MFS_2 1.00
PF13404HTH_AsnC-type 1.00
PF04167DUF402 1.00
PF00342PGI 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0166Glucose-6-phosphate isomeraseCarbohydrate transport and metabolism [G] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A58.00 %
All OrganismsrootAll Organisms42.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000043|ARcpr5yngRDRAFT_c010505Not Available785Open in IMG/M
3300000956|JGI10216J12902_100032866Not Available652Open in IMG/M
3300000956|JGI10216J12902_107188319Not Available673Open in IMG/M
3300001305|C688J14111_10067847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium1082Open in IMG/M
3300001305|C688J14111_10098288Not Available891Open in IMG/M
3300005174|Ga0066680_10600455Not Available689Open in IMG/M
3300005331|Ga0070670_100751360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium879Open in IMG/M
3300005332|Ga0066388_104047216Not Available747Open in IMG/M
3300005340|Ga0070689_101878821All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300005441|Ga0070700_101156652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium644Open in IMG/M
3300005445|Ga0070708_102046979Not Available530Open in IMG/M
3300005456|Ga0070678_100620989Not Available967Open in IMG/M
3300005458|Ga0070681_11250154Not Available665Open in IMG/M
3300005540|Ga0066697_10275096Not Available994Open in IMG/M
3300005564|Ga0070664_102022923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium547Open in IMG/M
3300005713|Ga0066905_100681424Not Available880Open in IMG/M
3300005764|Ga0066903_100544357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1987Open in IMG/M
3300006031|Ga0066651_10528487Not Available625Open in IMG/M
3300006578|Ga0074059_12090251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium851Open in IMG/M
3300006579|Ga0074054_11996612Not Available580Open in IMG/M
3300006580|Ga0074049_13037236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium1153Open in IMG/M
3300006604|Ga0074060_11820646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium519Open in IMG/M
3300006791|Ga0066653_10019198All Organisms → cellular organisms → Bacteria2536Open in IMG/M
3300006794|Ga0066658_10351278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium789Open in IMG/M
3300006969|Ga0075419_10584063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria783Open in IMG/M
3300009011|Ga0105251_10524236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300009177|Ga0105248_10655017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1185Open in IMG/M
3300010043|Ga0126380_12232704Not Available507Open in IMG/M
3300010117|Ga0127449_1001409Not Available547Open in IMG/M
3300010326|Ga0134065_10488026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium511Open in IMG/M
3300010336|Ga0134071_10607221Not Available572Open in IMG/M
3300010359|Ga0126376_11668687Not Available671Open in IMG/M
3300010375|Ga0105239_10116859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2960Open in IMG/M
3300012198|Ga0137364_10181187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1537Open in IMG/M
3300012201|Ga0137365_10554044Not Available844Open in IMG/M
3300012206|Ga0137380_11586158Not Available539Open in IMG/M
3300012210|Ga0137378_10066033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3277Open in IMG/M
3300012210|Ga0137378_11350096Not Available628Open in IMG/M
3300012211|Ga0137377_11455678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium612Open in IMG/M
3300012212|Ga0150985_115214516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1285Open in IMG/M
3300012488|Ga0157343_1024958Not Available567Open in IMG/M
3300012499|Ga0157350_1044376All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300012897|Ga0157285_10270098Not Available566Open in IMG/M
3300012911|Ga0157301_10245587Not Available627Open in IMG/M
3300012960|Ga0164301_11208775Not Available608Open in IMG/M
3300012984|Ga0164309_11493371Not Available578Open in IMG/M
3300012986|Ga0164304_10222675Not Available1247Open in IMG/M
3300013297|Ga0157378_12737509Not Available546Open in IMG/M
3300014166|Ga0134079_10189629Not Available855Open in IMG/M
3300014325|Ga0163163_12064705Not Available630Open in IMG/M
3300014497|Ga0182008_10407456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium731Open in IMG/M
3300014745|Ga0157377_11317523Not Available565Open in IMG/M
3300014969|Ga0157376_11743577Not Available658Open in IMG/M
3300015372|Ga0132256_103695596Not Available515Open in IMG/M
3300015374|Ga0132255_101182710Not Available1151Open in IMG/M
3300017947|Ga0187785_10608196Not Available562Open in IMG/M
3300018066|Ga0184617_1091682Not Available838Open in IMG/M
3300018433|Ga0066667_10014568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3950Open in IMG/M
3300018433|Ga0066667_10783460Not Available808Open in IMG/M
3300018482|Ga0066669_11731562Not Available575Open in IMG/M
3300019867|Ga0193704_1040230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium932Open in IMG/M
3300019877|Ga0193722_1042757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1159Open in IMG/M
3300019877|Ga0193722_1148479Not Available513Open in IMG/M
3300020004|Ga0193755_1086450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium1002Open in IMG/M
3300021078|Ga0210381_10087802Not Available993Open in IMG/M
3300022694|Ga0222623_10007784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3837Open in IMG/M
3300024219|Ga0247665_1046381Not Available598Open in IMG/M
3300025911|Ga0207654_10035652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2773Open in IMG/M
3300025911|Ga0207654_10493648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium864Open in IMG/M
3300025919|Ga0207657_11455345Not Available513Open in IMG/M
3300025926|Ga0207659_10388810Not Available1165Open in IMG/M
3300025930|Ga0207701_11406085Not Available568Open in IMG/M
3300025938|Ga0207704_11383033Not Available603Open in IMG/M
3300025939|Ga0207665_10277086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1247Open in IMG/M
3300025944|Ga0207661_10656178Not Available964Open in IMG/M
3300025944|Ga0207661_11079878Not Available739Open in IMG/M
3300026078|Ga0207702_11474514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria674Open in IMG/M
3300026088|Ga0207641_12214445Not Available550Open in IMG/M
3300026306|Ga0209468_1060212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1279Open in IMG/M
3300026323|Ga0209472_1072051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1424Open in IMG/M
3300026342|Ga0209057_1194134Not Available579Open in IMG/M
3300026827|Ga0207591_101279Not Available936Open in IMG/M
3300028708|Ga0307295_10162049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium624Open in IMG/M
3300028717|Ga0307298_10003331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3800Open in IMG/M
3300028718|Ga0307307_10092661Not Available916Open in IMG/M
3300028784|Ga0307282_10155374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium1084Open in IMG/M
3300028784|Ga0307282_10421457Not Available647Open in IMG/M
3300028799|Ga0307284_10091052Not Available1130Open in IMG/M
3300028799|Ga0307284_10259934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium692Open in IMG/M
3300028810|Ga0307294_10004970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3195Open in IMG/M
3300028811|Ga0307292_10023302Not Available2195Open in IMG/M
3300028819|Ga0307296_10522355Not Available649Open in IMG/M
3300028824|Ga0307310_10003421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales6036Open in IMG/M
3300028876|Ga0307286_10140530Not Available861Open in IMG/M
3300028880|Ga0307300_10012286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2187Open in IMG/M
3300031093|Ga0308197_10224448Not Available653Open in IMG/M
3300031198|Ga0307500_10246789Not Available550Open in IMG/M
3300031938|Ga0308175_100030234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4466Open in IMG/M
3300031996|Ga0308176_10411272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1353Open in IMG/M
3300033551|Ga0247830_11709736Not Available504Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil24.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.00%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.00%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.00%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.00%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000043Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphereHost-AssociatedOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010117Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012488Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610Host-AssociatedOpen in IMG/M
3300012499Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300024219Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026827Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A4-11 (SPAdes)EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ARcpr5yngRDRAFT_01050523300000043Arabidopsis RhizosphereMTSVAVEAKQPRRSALSATWAFVKRHVLTVYSLLFFVYLLLPIAIVVVF
JGI10216J12902_10003286623300000956SoilMSAVAVEARRPRKSALATAWAFVKHHALTVYSLLFFAYLLLPIG
JGI10216J12902_10718831923300000956SoilMSVVAVRTGRPRRSVLAAVWAFVKRYALAVYSLLFFAYLMLPI
C688J14111_1006784733300001305SoilVQRSRPRRGVLASTWAFVKRHVLTVYSILFFLYLLL
C688J14111_1009828813300001305SoilMSAVAVERHTARPSAVSRVLAFVRRHVLTVYSILFFIYLLLPI
Ga0066680_1060045523300005174SoilMSSVAVPALSRRYTLATTLRFVRRHLLTAYSILFFAYLLLP
Ga0070670_10075136023300005331Switchgrass RhizosphereMSLVAVPAQGRASAAVKVWAFVKHHLLAVYSMLFFLYLLLP
Ga0066388_10404721613300005332Tropical Forest SoilVSAVAVQRSRPKRGVLASVWTFVKRNVLTVYSILFFIYLLLPI
Ga0070689_10187882123300005340Switchgrass RhizosphereMSAVAVERARTRRSAFATAWAFVKRHVLTVYSILFFVYLLVPIAVVAVFSFNN
Ga0070700_10115665223300005441Corn, Switchgrass And Miscanthus RhizosphereMSAVAVERARTRGSALATAWAFVKRHLLTVYSILFFAYLLLPIAV
Ga0070708_10204697923300005445Corn, Switchgrass And Miscanthus RhizosphereLSAVAVQRNRPRRSVLASVWAFVKRNVLTVYSILFFIYLMLPIAVV
Ga0070678_10062098923300005456Miscanthus RhizosphereLSAVAVQPNRPRRGVLASTWTFVKRHVLTVYSVLFFVYLLLPIAVVV
Ga0070681_1125015413300005458Corn RhizosphereMSAVAVERRERRNPLAGIWAFVKRNVLTVYSILFFVYLLLPIAVVIVF
Ga0066697_1027509613300005540SoilMSSIAVPTAREPNVLATVLAFVRRHVLTVYSFLFFAYLLLPIAV
Ga0070664_10202292313300005564Corn RhizosphereVSAVAVEGGRARGGALSGAWAFVKRHVLTVYSILFFAYLLLPIAVVAVF
Ga0066905_10068142423300005713Tropical Forest SoilMSTVAVPAPRERNVLASVWAFVRRHVLTVYSILFFIYLLL
Ga0066903_10054435713300005764Tropical Forest SoilMSAVAVPARAQRRNVLASVWAFVRRHVLTVYSILFFAYLLLPI
Ga0066651_1052848723300006031SoilMSSIAVPRQRERNVLAAAFGFVRYHVLTVYSLLFFA
Ga0074059_1209025123300006578SoilMSTVAVPARRERRGVLSAVWAFVKRHVLTVYSILFFAYLLLPIAVVVV
Ga0074054_1199661213300006579SoilMTTVVVEAKQPRGSALSATWAFVKRHILTVYSLLFFA
Ga0074049_1303723623300006580SoilMTTAVVEAGRPRRSVLARTWAFVKRHILTVYSLLFFAYL
Ga0074060_1182064613300006604SoilMSTVAVPARRERRGVLSAVWAFVKRHVLTVYSILFFAYLLLPI
Ga0066653_1001919813300006791SoilMSAVAATAQPRARNFAASAWAFVKHHVLTVYSILFFLYLLLP
Ga0066658_1035127823300006794SoilMTSVAVSAPRRRSATSVWAFARRNVLTVYSILFFAYLLL
Ga0075419_1058406313300006969Populus RhizosphereMSTVAVERATRTNVLSRVWTFVKHHILTVYSILFFVYLLLPIAVVVVFSFNNP
Ga0105251_1052423623300009011Switchgrass RhizosphereMSAVAVERARTRRSAFATAWAFVKRHVLTVYSILFFVYLLVPIAVVAVFSFNNP
Ga0105248_1065501733300009177Switchgrass RhizosphereMSAVAGERGRTRGSAFATAWAFVKRHVLTVYSILFFVYLL
Ga0126380_1223270413300010043Tropical Forest SoilLSAVAVQRSRPGRGVLASTWAFVKRHVLTVYSILFFVYLLLPIAVVVL
Ga0127449_100140913300010117Grasslands SoilMSAVAVERRAGRPSVLARAWAFVRHHLLTVYSILFFAYLLLPIAVVV
Ga0134065_1048802613300010326Grasslands SoilLTSVAVQRSRPRRGVLASTWAFVKRHVLTVYSILFFAY
Ga0134071_1060722133300010336Grasslands SoilMSSIAVPARREGGNALRSVLAFIRRHVLTVYSLLFFAYLLLPIAV
Ga0126376_1166868713300010359Tropical Forest SoilMSAVAVQRGRPKRGVLASTWTFVKRHVLTVYSILFFIYLLLPIAVVNSK*
Ga0105239_1011685913300010375Corn RhizosphereLSAVAVQPNRPRRGVLASTWTFVKRHVLTVYSVLF
Ga0137364_1018118713300012198Vadose Zone SoilMSSIAVDQRAGRSPAAAALAFVRRHILTAYSVLFFAYLLLPIAVVVVF
Ga0137365_1055404413300012201Vadose Zone SoilMSSIAVSAQREGNVLRTSLAFVRRHVLTVYSLLFFAYLLL
Ga0137380_1158615813300012206Vadose Zone SoilMSSIAVEQRAGRGPAAAALAFVRRHILTVYSVLFFAY
Ga0137378_1006603343300012210Vadose Zone SoilMSAVAVEGGRERHLATTLWAFVRRHLPTLYSFLFFAYLLLPIA
Ga0137378_1135009623300012210Vadose Zone SoilLSAVAVDRSHSRRSTPAAAWAFVKRHVLTLYSALFFAYLM
Ga0137377_1145567813300012211Vadose Zone SoilLSAVAVERSWPRRRVLASTWAFVKRHVLTVYSVLFFLYL
Ga0150985_11521451633300012212Avena Fatua RhizosphereVNAVAVERHTVRPNAVSRALAFVRRHVLTVYSILFFVYLLLPIAVVVVFS
Ga0157343_102495813300012488Arabidopsis RhizosphereMSAVAATTASPRRNPLAAVWAFVRHHVLTVYSILFF
Ga0157350_104437623300012499Unplanted SoilMSTVAVERATRTNVLSRVWTFVKHHILTVYSILFFVYLLLPIAVVVVF*
Ga0157285_1027009823300012897SoilMSAVAVERARTRGSALATAWAFVKRHVLTVYSLLF
Ga0157301_1024558723300012911SoilMSAVAVERARTRGSALATAWAFVKRHVLTVYSHLFFAYLLLPIAVI
Ga0164301_1120877523300012960SoilMSAVAVERRERRNPLAGIWAFVKRNVLTVYSILFFVYLLLPIAVVIVFSF
Ga0164309_1149337113300012984SoilMSSIAVPARSRRNTLATTLGFVRRHLLTAYSILFFAYLLLPIAVVILFS
Ga0164304_1022267533300012986SoilMSAVAVEQRRARAGFLTDAWAFVKHHVLTVYSILFFAYLLLPIGVVVLFSFN
Ga0157378_1273750923300013297Miscanthus RhizosphereLSAVAVQPNRPRRGVLASTWTFVKRHALTVYSVLFFVYLLLP
Ga0134079_1018962923300014166Grasslands SoilMSSIAVPARREGSNALRTVLSFIRRHVLTVYSLLFFVY
Ga0163163_1206470523300014325Switchgrass RhizosphereMSVVAVRTGRPRRSVLAAVWAFVKRYALAVYSLLFFAYLML
Ga0182008_1040745613300014497RhizosphereMSAVAVPAGSRVGAAAGVWAFVKRHVLTVYSILFFLYLLLPIGV
Ga0157377_1131752313300014745Miscanthus RhizosphereMSAVAATTASPRRNPLAAVWAFVRHHVLTVYSILFFV
Ga0157376_1174357723300014969Miscanthus RhizosphereMSAVAVERSRPKRGVLASTWAFVKRHVLTVYSILFFIYLLLPIAVVVVF
Ga0132256_10369559613300015372Arabidopsis RhizosphereMTTATEAIQAPAQRVRTSPLAFVRRHVLTVYSLLVFAYLLLPIVIVV
Ga0132255_10118271013300015374Arabidopsis RhizosphereVSAVAAERSRPRRGALASTWAFVKRNVLAAYSILFFIYLLLPIAVVVAFSF
Ga0187785_1060819623300017947Tropical PeatlandVSAVAAERPPAGRSFAASTWDLVKRHVLTVYSILFFV
Ga0184617_109168213300018066Groundwater SedimentMSAVAVEAQRERRSFLAAAWAFVKHHILTLYSILFFAYLLIPIAV
Ga0066667_1001456863300018433Grasslands SoilMSSIAVPRQRERNVLAAAFGFVRYHVLTVYSLLFFAYLL
Ga0066667_1078346023300018433Grasslands SoilMSSAAAAVRSRPSVAAGVWAFARHHVLTVYSILFFLYLLLPIAI
Ga0066669_1173156213300018482Grasslands SoilMSSIAVPRQRERNVLAAAFGFVRYHVLTVYSLLFFAYLLLPIAIVVV
Ga0193704_104023023300019867SoilMSSIAVPARSRRNPLATTLGFVRRHLLTAYSILFFAYLLLPIAVVILFS
Ga0193722_104275713300019877SoilMSAVAVATQPRRGLLAAAWAFVRHHLLTLYSFLFFAYLLFPI
Ga0193722_114847913300019877SoilMSSIAVPARSRRNPLATTLGFVRRHLLTAYSILFFAY
Ga0193755_108645013300020004SoilMSTVAVPARRERPGFLAAAWAFVKRHVLTVYSILFFAYLLLPIAVVVVFSF
Ga0210381_1008780213300021078Groundwater SedimentMSSIAVDQQAGRRPAAAALAFVRRHILTVYSVLFFAYLLLPIAVV
Ga0222623_1000778413300022694Groundwater SedimentMSSIAVPARSRRNPLATTLGFVRRHLLTAYSILFFAYLL
Ga0247665_104638113300024219SoilMSAVAVERARTRGSAPATAWAFVKRHVLTVYSVLFFAYLLLPIAVVA
Ga0207654_1003565213300025911Corn RhizosphereLSAVAVQPNRPRRGVLASTWTFVKRHVLTVYSVLFFVYLLLPIAVV
Ga0207654_1049364823300025911Corn RhizosphereVSAVAVEGGRARGGALSGAWAFVKRHVLTVYSILFFAYLLLPIAVV
Ga0207657_1145534513300025919Corn RhizosphereLSAVAVQRNRPRRSVLASVWAFVKRNVLTVYSILFFIY
Ga0207659_1038881033300025926Miscanthus RhizosphereLSAVAVQRNRPRRSVLASVWAFVKRNVLTVYSILFFIYLMLPIAVVVVFS
Ga0207701_1140608513300025930Corn, Switchgrass And Miscanthus RhizosphereMSAVAVERRERRNPLAGIWAFVKRNVLTVYSILFFVY
Ga0207704_1138303313300025938Miscanthus RhizosphereLSAVAVQPNRPRRGVLASTWTFVKRHVLTVYSVLFFVNLLLPIAVVVV
Ga0207665_1027708633300025939Corn, Switchgrass And Miscanthus RhizosphereMSAVAVDQRRPRAGFFAAAWAFVKHHVLTVYSILFFGYLLLPIGV
Ga0207661_1065617823300025944Corn RhizosphereMSAVAMPARQKANPVVSLWAFVRRHTLTVYSVLFF
Ga0207661_1107987813300025944Corn RhizosphereMSAVAVERARTRGSAPATAWAFVKRHVLTVYSVLFFAY
Ga0207702_1147451423300026078Corn RhizosphereMSAVAVERARTRGSIFATAWAFVKRHVLTVYSILFFVYLLVPIAVVAV
Ga0207641_1221444513300026088Switchgrass RhizosphereMSAVAATTASPRRNPLAAVWAFVRHHVLTVYSILFFVYLLLPIAVVVLF
Ga0209468_106021213300026306SoilMSAVAATAQPRARNFAASAWAFVKHHVLTVYSILFFLYLL
Ga0209472_107205113300026323SoilMSSIAVPRQRERNVLAAAFGFVRYHVLTVYSLLFFAYLLLPIAIVVVFS
Ga0209057_119413413300026342SoilMSSIAVPTAREPNVLATVLAFVRRHVLTVYSLLFF
Ga0207591_10127923300026827SoilMSTVAVERATRTNVLSKVWTFVKHHILTVYSILFFVYLLLPIAV
Ga0307295_1016204913300028708SoilMSSIAVPARSRRNPLATTLGFVRRHLLTAYSILFFAYLLL
Ga0307298_1000333113300028717SoilMSAVAVEPRRERTNLLAKVLAFVRHHLLTAYSLLFFAYLLLPIAVVV
Ga0307307_1009266113300028718SoilLSSIAAPARRERSVLATVLAFVRRKALAVYSLLFFAYLLLPI
Ga0307282_1015537413300028784SoilMSSIAVPRQRERNVLAAALGFVRYHVLTVYSLLFFAYLLLPIAIVVV
Ga0307282_1042145713300028784SoilMSSIAAPVRRERSVLATVLAFVRRHALAAYSLLFFAYLLLPI
Ga0307284_1009105213300028799SoilMSSIAVPVRRQGNALAKTFAFVRRHVLTVYSLLFF
Ga0307284_1025993413300028799SoilLSSIAAPARRERSVLATVLAFVRRHALAAYSLLFFAYLLLPIAIVIAFS
Ga0307294_1000497043300028810SoilMSAVAVERARPNVFSKVWAFVRHHILTAYSILFFVYLLLPIAVVVV
Ga0307292_1002330223300028811SoilMSSIAVTRARERNVLGATLGFVRHHILTVYSLLFFAYLLLPIAIVVAF
Ga0307296_1052235523300028819SoilLSSIAAPARRERSVLATVLAFVRRKALAVYSLLFFAYLLLPIAIV
Ga0307310_1000342183300028824SoilMSAVAVESRPRRHVLAGAWAFVRRHILTVYSVLFF
Ga0307286_1014053013300028876SoilMSTVAVPARRERRGFLSAVWAFVKRHVLTVYSILFFAYLLLPIAVVV
Ga0307300_1001228613300028880SoilMSAVAVSAPRRSRGLARVWAFVRRHVLTVSAMLGFAYLL
Ga0308197_1022444813300031093SoilMSSIAVTRERERNVLGAALGFVRHHILSVYSLLFFA
Ga0307500_1024678913300031198SoilVSSATAVSARPRRSALANVWAFVRRHVLTAYSILFFIY
Ga0308175_10003023413300031938SoilMSAIAVERARTRGSALATTWAFVKRHVLTVYSILFFAYLL
Ga0308176_1041127213300031996SoilVTTVAIERRPGRPSVLAKTWSFVRRHVLTAYSILFFVYLLLPIA
Ga0247830_1170973623300033551SoilMSTVAVPAGRERPGFLAAAWAFVKRHVLTVYSILFFAYLL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.