NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F104932

Metagenome Family F104932

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F104932
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 48 residues
Representative Sequence PRVVVVTGYGEPYLTRARQAGAEVVFTKPVEWSRILEWLERPDLAASA
Number of Associated Samples 90
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.00 %
% of genes near scaffold ends (potentially truncated) 98.00 %
% of genes from short scaffolds (< 2000 bps) 92.00 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.65

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(15.000 % of family members)
Environment Ontology (ENVO) Unclassified
(34.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(42.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.32%    β-sheet: 10.53%    Coil/Unstructured: 63.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.65
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF01977UbiD 41.00
PF03773ArsP_1 41.00
PF00072Response_reg 2.00
PF01040UbiA 2.00
PF01209Ubie_methyltran 2.00
PF00989PAS 1.00
PF13560HTH_31 1.00
PF00561Abhydrolase_1 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 41.00
COG0701Uncharacterized membrane protein YraQ, UPF0718 familyFunction unknown [S] 41.00
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 2.00
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 2.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.00 %
UnclassifiedrootN/A1.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664022|INPgaii200_c0953017All Organisms → cellular organisms → Bacteria1376Open in IMG/M
2228664022|INPgaii200_c0955211All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300002562|JGI25382J37095_10274653All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300004480|Ga0062592_100739519All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300005171|Ga0066677_10348328All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300005328|Ga0070676_11008948All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium625Open in IMG/M
3300005332|Ga0066388_103739252All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300005340|Ga0070689_100506997All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300005341|Ga0070691_10364420All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium806Open in IMG/M
3300005445|Ga0070708_100227116All Organisms → cellular organisms → Bacteria1751Open in IMG/M
3300005445|Ga0070708_101325232All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300005451|Ga0066681_10365007All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300005536|Ga0070697_100574223All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300005540|Ga0066697_10565238All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria635Open in IMG/M
3300005545|Ga0070695_100456924All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300005555|Ga0066692_10786006All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria586Open in IMG/M
3300005566|Ga0066693_10204067All Organisms → cellular organisms → Bacteria → Proteobacteria768Open in IMG/M
3300005569|Ga0066705_10672959All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria626Open in IMG/M
3300005615|Ga0070702_101348999All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300005617|Ga0068859_102600979All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium557Open in IMG/M
3300005713|Ga0066905_100630914All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300005843|Ga0068860_102233795All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium568Open in IMG/M
3300006755|Ga0079222_10545813All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300006800|Ga0066660_11582032All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria519Open in IMG/M
3300006804|Ga0079221_10823378All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria669Open in IMG/M
3300006845|Ga0075421_100380388All Organisms → cellular organisms → Bacteria1699Open in IMG/M
3300006845|Ga0075421_101674087All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria689Open in IMG/M
3300006854|Ga0075425_100109886All Organisms → cellular organisms → Bacteria3142Open in IMG/M
3300006881|Ga0068865_102056389All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium519Open in IMG/M
3300006969|Ga0075419_10493341All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300006969|Ga0075419_10909923All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria635Open in IMG/M
3300007004|Ga0079218_13699976All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium520Open in IMG/M
3300007076|Ga0075435_101323475All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria631Open in IMG/M
3300007265|Ga0099794_10234837All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300009090|Ga0099827_10004218All Organisms → cellular organisms → Bacteria → Proteobacteria8398Open in IMG/M
3300009094|Ga0111539_10412653Not Available1573Open in IMG/M
3300009094|Ga0111539_10669426All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300009147|Ga0114129_12440215All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria626Open in IMG/M
3300009691|Ga0114944_1027991All Organisms → cellular organisms → Bacteria1988Open in IMG/M
3300009819|Ga0105087_1126107All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria501Open in IMG/M
3300010325|Ga0134064_10262977All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria643Open in IMG/M
3300010325|Ga0134064_10504304All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300010329|Ga0134111_10381753All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria600Open in IMG/M
3300010366|Ga0126379_10279167All Organisms → cellular organisms → Bacteria1663Open in IMG/M
3300011269|Ga0137392_10533615All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300011269|Ga0137392_11175417All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria625Open in IMG/M
3300012189|Ga0137388_11693994All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium566Open in IMG/M
3300012200|Ga0137382_10876588All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria647Open in IMG/M
3300012285|Ga0137370_10413974All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria817Open in IMG/M
3300012362|Ga0137361_11065801All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria729Open in IMG/M
3300012363|Ga0137390_11093024All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium747Open in IMG/M
3300012685|Ga0137397_10282356All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1237Open in IMG/M
3300012927|Ga0137416_11227917All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria675Open in IMG/M
3300012944|Ga0137410_10298956All Organisms → cellular organisms → Bacteria1274Open in IMG/M
3300012944|Ga0137410_10426680All Organisms → cellular organisms → Bacteria1073Open in IMG/M
3300014320|Ga0075342_1251341All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium514Open in IMG/M
3300015054|Ga0137420_1233757All Organisms → cellular organisms → Bacteria2602Open in IMG/M
3300015357|Ga0134072_10113139All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300015374|Ga0132255_105025251All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria560Open in IMG/M
3300018000|Ga0184604_10122049All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300018422|Ga0190265_12021090All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300018431|Ga0066655_10008725All Organisms → cellular organisms → Bacteria4295Open in IMG/M
3300018433|Ga0066667_10236573All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1373Open in IMG/M
3300019360|Ga0187894_10519221All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium514Open in IMG/M
3300025324|Ga0209640_10718802All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300025922|Ga0207646_10057848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3464Open in IMG/M
3300025945|Ga0207679_11714709All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria575Open in IMG/M
3300025961|Ga0207712_11028740All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium731Open in IMG/M
3300026044|Ga0208287_1016057All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria679Open in IMG/M
3300026075|Ga0207708_11050379All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium709Open in IMG/M
3300026300|Ga0209027_1091974All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300026309|Ga0209055_1034103All Organisms → cellular organisms → Bacteria2300Open in IMG/M
3300026317|Ga0209154_1295267All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria535Open in IMG/M
3300026527|Ga0209059_1181555All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300026528|Ga0209378_1231563All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria589Open in IMG/M
3300026537|Ga0209157_1208463All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300027691|Ga0209485_1331922All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria511Open in IMG/M
3300027846|Ga0209180_10446163All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria729Open in IMG/M
3300027873|Ga0209814_10410080All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300027949|Ga0209860_1060751All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria501Open in IMG/M
3300028590|Ga0247823_10550161All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300028792|Ga0307504_10355097All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium566Open in IMG/M
3300031170|Ga0307498_10202659All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria693Open in IMG/M
3300031229|Ga0299913_10770593All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria937Open in IMG/M
3300031548|Ga0307408_100387439All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300031548|Ga0307408_101319034All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium677Open in IMG/M
3300031716|Ga0310813_10053234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2990Open in IMG/M
3300031720|Ga0307469_12460069All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium509Open in IMG/M
3300031731|Ga0307405_11212542All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300031820|Ga0307473_10290873All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300031824|Ga0307413_10906641All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria749Open in IMG/M
3300031944|Ga0310884_11061241All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300031995|Ga0307409_102056370All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium601Open in IMG/M
3300032000|Ga0310903_10157686All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300032003|Ga0310897_10112560All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300032017|Ga0310899_10218680All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300032075|Ga0310890_11537767All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria549Open in IMG/M
3300032126|Ga0307415_100380851All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300033551|Ga0247830_10005005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi6514Open in IMG/M
3300033551|Ga0247830_10114414All Organisms → cellular organisms → Bacteria1920Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil13.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil8.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere6.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.00%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.00%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.00%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs1.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.00%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.00%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009691Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2EnvironmentalOpen in IMG/M
3300009819Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014320Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026044Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027949Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300028590Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPgaii200_095301732228664022SoilLRSRSGHTTRVLVVTGYGEPFLSRARQAGADVVFTKPVEWSRILEYLERPDLAASA
INPgaii200_095521112228664022SoilRSGHTTRVLVVTGYGEPFLSRARQAGADVVFTKPVEWSRILEYLERPDLAASA
JGI25382J37095_1027465313300002562Grasslands SoilRSRSGRGTRVMVVTGYGEPYLTRARQAGADVVFTKPVEWSRILEYLERPDLAASA*
Ga0062592_10073951933300004480SoilLTTARGRTRVIVVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLERPGLAASA*
Ga0066677_1034832813300005171SoilRVMVVTGYGEPFLTRARQAGADVVFTKPVEWSRILEYLERSDLAASA*
Ga0070676_1100894823300005328Miscanthus RhizosphereAGARGRPRVVVVTGYGEPYLTRARQAGAEVVFTKPVEWSRILEWLERPDLAASA*
Ga0066388_10373925223300005332Tropical Forest SoilVVVITGYGEPYVSRARQAGADAVFTKPVEWTNILDYIRRPDLAASA*
Ga0070689_10050699733300005340Switchgrass RhizosphereTGYGEPFISRARAAGADVVFTKPVEWTRVLDFLHERRLPASA*
Ga0070691_1036442033300005341Corn, Switchgrass And Miscanthus RhizosphereLASARGRTRVVVVTGYGEPYLSRARQAGAEVVFTKPVEWSRILEWLERPDLAASA*
Ga0070708_10022711633300005445Corn, Switchgrass And Miscanthus RhizosphereMVVTGYGEPFLTRARQAGADVVFTKPVEWSRILEYIERSDLAASA*
Ga0070708_10132523223300005445Corn, Switchgrass And Miscanthus RhizosphereSGAATRVVVITGYGEPYLTRARQAGADAVFTKPVEWTYILDYLRRPDLAASA*
Ga0066681_1036500723300005451SoilRIVVVTGYGEPYLSRARQAGAEVVFTKPVEWSRILEWLERPDLAASA*
Ga0070697_10057422323300005536Corn, Switchgrass And Miscanthus RhizosphereVVITGYGEPYLTRARHAGADAVFTKPVEWTRILDYIRRPDFAVSA*
Ga0066697_1056523813300005540SoilPFLARARQAGADVVFTKPVEWSRILEYLEHPDFAASA*
Ga0070695_10045692433300005545Corn, Switchgrass And Miscanthus RhizosphereLIRELRSRSGLTTRVLVVTGYGEPFLSRARQAGADVVFTKPVEWSRILEYLERPDLAASA
Ga0066692_1078600623300005555SoilPFLSRARQAGADVVFTKPVEWSRILEYLERRDLAASA*
Ga0066693_1020406733300005566SoilTGYGEPYLTRARQAGAEVVFTKPVEWTRILAYLERPGLAASA*
Ga0066705_1067295913300005569SoilSGRATRVMVVTGYGEPFLTRARQAGADVVFTKPVEWSRILEYLERSDLAASA*
Ga0070702_10134899913300005615Corn, Switchgrass And Miscanthus RhizosphereVPHHARIVVITGYGEPYLTRARRAGADVVLTKPVEWKRVLAALQPPGLAASA*
Ga0068859_10260097913300005617Switchgrass RhizosphereIRQILAGARGRTRVVVVTGYGEPYLTRARQAGAEVVFTKPVEWSRILEWLERPDLAASA*
Ga0066905_10063091413300005713Tropical Forest SoilSTHRRPRIAVITGYGEPYLTRARQAGAHAVFTKPVEWTRVVDYLCRPDLAASA*
Ga0068860_10223379523300005843Switchgrass RhizosphereRQILAGARGRTRVVVVTGYGEPYLTRARQAGAEVVFTKPVEWSRILEWLERPDLAASA*
Ga0079222_1054581313300006755Agricultural SoilHAGRATRVMVVTGYGEPFLSRARQAGADVVFTKPVEWSRILEYLERPDFAASA*
Ga0066660_1158203213300006800SoilRVMVVTGYGEPFLTRARQAGADVVFTKPVEWSRILEYIERSDLAASA*
Ga0079221_1082337823300006804Agricultural SoilYGEPFLSRARQAGADVVFTKPVEWSRILEYLERPDLAASA*
Ga0075421_10038038833300006845Populus RhizosphereKGRTRVVVVTGYGEPYLSRARQAGADVVFTKPVEWSRILDYLSRTDLAASA*
Ga0075421_10167408713300006845Populus RhizosphereLASARKGTRVVVITGYGEPYLTRARQAGAEVVFTKPVEWTRILDYLHRPGLAASA*
Ga0075425_10010988613300006854Populus RhizosphereVLIRELRSRSGHTTRVLVVTGYGEPFLSRARQAGADVVFTKPVEWSRILEYLERPDLAASA*
Ga0068865_10205638913300006881Miscanthus RhizosphereEPYLTRARQAGAEVVFTKPVEWSRILEWLERPDLAASA*
Ga0075419_1049334113300006969Populus RhizosphereIVVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLEKPGLAASA*
Ga0075419_1090992323300006969Populus RhizosphereELRSRSGQDTRVLVVTGYGEPFLSRARQAGANVVFTKPVEWSRILEYLERPDLAASA*
Ga0079218_1369997613300007004Agricultural SoilLAATRNRTRVIVITGYGEPYRTRARQAGAEVVFTKPVEWAGILDYLQRPGLAASA*
Ga0075435_10132347523300007076Populus RhizosphereYLSRARQAGADVVFTKPVEWSRILEYLSRTDLAASA*
Ga0099794_1023483733300007265Vadose Zone SoilYLTRARQAGAHAVFTKPVEWTRVVDYLCRPDLAASA*
Ga0099827_1000421833300009090Vadose Zone SoilVITGYGEPYLTRARQAGADAVFTKPVEWSRVLDYLRRPDLAASA*
Ga0111539_1041265313300009094Populus RhizospherePRVVVVTGYGEPYLTRARQAGAEVVFTKPVEWSRILEWLERPDLAASA*
Ga0111539_1066942633300009094Populus RhizosphereYLTRARQAGAEVVFTKPVEWTRILDYLHRPGLAASA*
Ga0114129_1244021523300009147Populus RhizosphereRSRSGHTTRVLVVTGYGEPFLSRARQAGADVVFTKPVEWSRILEYLERPDLAASA*
Ga0114944_102799113300009691Thermal SpringsRIIVVTGYGEPYLTRARQAGADVVFTKPVEWMRILDYLQRSGLAASA*
Ga0105087_112610713300009819Groundwater SandTRVLVVTGYGEPYLTRARQAGAHVVFTKPVEWSRILEALQRPDLAASA*
Ga0134064_1026297723300010325Grasslands SoilRELRARSARATRVVVVTGYGEPFLARARQAGADVVFTKPVEWSRILEYLEHPDFAASA*
Ga0134064_1050430423300010325Grasslands SoilELRARSGRATRVMVVTGYGEPFLTRARQAGADVVFTKPVEWSRILEYLERSDLAASA*
Ga0134111_1038175323300010329Grasslands SoilIVITGYGEPYLSRARQAGAEVVFTKPVEWTRILDYLHRPGLAASA*
Ga0126379_1027916733300010366Tropical Forest SoilEPFTSRARQAGADVVFTKPVEWTRVLDFLHQRRLPASA*
Ga0137392_1053361533300011269Vadose Zone SoilYGEPYLTRARQAGADAVFTKPVEWSRVLDYLRRPDLAASA*
Ga0137392_1117541723300011269Vadose Zone SoilRRRTRVVVVTGCGEPYLTRARQAGAEAVFTKPVEWTRILDWLQRPGLAASA*
Ga0137388_1169399413300012189Vadose Zone SoilRVVVITGYGEPYLTRARHSWADAVFTKPVEWTRILDYIRHPDLAVSA*
Ga0137382_1087658823300012200Vadose Zone SoilVTGYGEPFLTRARQAGADVVFTKPVEWSRILEYLERSDLAASA*
Ga0137370_1041397433300012285Vadose Zone SoilPTTRVMVVTGYGEPFLSRARQAGADVVFTKPVEWSRILEYLERPDLAASA*
Ga0137361_1106580123300012362Vadose Zone SoilVVTGYGEPFLTRARQAGADVVFTKPVEWSRILEYLERSDLAASA*
Ga0137390_1109302423300012363Vadose Zone SoilVLVRQLRAGSANGTRVVVITGYGEPYLTRARHAGADAVFTKPVEWTRILDYIRHPDLAVSA*
Ga0137397_1028235643300012685Vadose Zone SoilAARGRTRVAVVTGCGEPYLTRARQAGAEAVFTKPVEWTSILDWLQRPGLAASA*
Ga0137416_1122791723300012927Vadose Zone SoilMVVTGYGEPFLSRARQAGADVVFTKPVEWSRILEYLERPDFAASA*
Ga0137410_1029895633300012944Vadose Zone SoilVLIRELRARSGRGTRVMVVTGYGEPFLSRARQAGADVVFTKPVEWSRILEYLGRPDFAASA*
Ga0137410_1042668013300012944Vadose Zone SoilTGYGEPFLTRARQAGADVVFTKPVEWSRILEYIERSDLAASA*
Ga0075342_125134113300014320Natural And Restored WetlandsVTGYGEPYLSRARQAGAEVVFTKPVEWTRILEWLERPGLAA
Ga0137420_123375713300015054Vadose Zone SoilELRARSGRATRVMVVTGYGEPFLTRARQAGADVVFTKPVEWSRILEYIERSDLAASA*
Ga0134072_1011313933300015357Grasslands SoilELRARSGRSTRVMVVTGYGEPFLSRARQAGADVVFTKPVEWSRILDYLERRDLAASA*
Ga0132255_10502525123300015374Arabidopsis RhizosphereRRRARVIVVTGYGEPYLTRARQAGADVVFTKPVEWSQVLEAIDKPDLAASA*
Ga0184604_1012204913300018000Groundwater SedimentAHRRTRVIVVTGYGEPYLTRARQAGAEIVFTKPVEWTRVLEWLEKPGLAASA
Ga0190265_1202109013300018422SoilTYLTRARQAGAEVVFTKPVEWTRILDYLHRPGLAASA
Ga0066655_1000872573300018431Grasslands SoilRATRVVVVTGYGEPFLARARQAGADVVFTKPVEWSRILEYLEHPDLAASA
Ga0066667_1023657333300018433Grasslands SoilLIRQILAGARRRTRVVVVTGYGEPYLSRARQAGAEVVFTKPVEWARILEWLQHPDLAASA
Ga0187894_1051922113300019360Microbial Mat On RocksGGNTTRVIVVTGYGAPYLTRARQAGADAVFTKPVEWTRILDYLRRPDLAASA
Ga0209640_1071880213300025324SoilYLSRARQAGAEVVFTKPVEWTRILEWLERPGLAASA
Ga0207646_1005784813300025922Corn, Switchgrass And Miscanthus RhizosphereIAGDTLVRQIRAASANGTRVVVITGYGEPYLTRARHAGADAVFTKPVEWTRILDYIRRPDFAVSA
Ga0207679_1171470913300025945Corn RhizosphereLSTCRTRACVIVITGYGEPFISRARAAGADIVFTKPVEWTRVLDFLHERRLPASA
Ga0207712_1102874013300025961Switchgrass RhizosphereVVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLERPGLAASA
Ga0208287_101605723300026044Natural And Restored WetlandsYGEPYLTRARQAGAHVVFTKPVEWSRILDALQRPDLAASA
Ga0207708_1105037913300026075Corn, Switchgrass And Miscanthus RhizosphereLTTARGRTRIIVVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLERPGLAASA
Ga0209027_109197433300026300Grasslands SoilLTRARQAGADVVFTKPVEWSRILEYIERSDLAASA
Ga0209055_103410313300026309SoilGRATRVMVVTGYGEPFLTRARQAGADVVFTKPVEWSRILEYIERSDLAASA
Ga0209154_129526723300026317SoilYGEPFLTRARQAGADVVFTKPVEWSRILEYLERSDLAASA
Ga0209059_118155523300026527SoilMDGPRVMVVTGYGEPFLSRARQAGADVVFTKPVEWTRILDWLQRPDLAASA
Ga0209378_123156313300026528SoilGYGEPFLSRARQAGADVVFTKPVEWSRILDYLERRDLAASA
Ga0209157_120846333300026537SoilYGEPYLTRARQAGAHAVFTKPVEWTRVVDYLCRPDLAASA
Ga0209485_133192223300027691Agricultural SoilGYGEPYLTRAKQAGAQVVFTKPVEWSRILEALQRPDLAASA
Ga0209180_1044616313300027846Vadose Zone SoilVRQMSNGARARLRILVITGYGEPYLTRARQAGADAVFTKPVEWSRVLDYLRRPDLAASA
Ga0209814_1041008013300027873Populus RhizosphereVLIRQILSTARGRPRVIVVTGYGEPYLSRARQAGAEVVFTKPVEWTRILEALERPGLAAS
Ga0209860_106075113300027949Groundwater SandQSRGRTRVLVVTGYGEPYLTRARQAGAHVVFTKPVEWSRILEALQRPDLAASA
Ga0247823_1055016113300028590SoilVTGYGEPYLTRARQAGADVVFTKQVEWAQVLESLDKPDLAASA
Ga0307504_1035509723300028792SoilRAGSARGTRVVVITGYGEPYLTRARHAGADAVFTKPVEWTRILDYIRRPDLAVSA
Ga0307498_1020265913300031170SoilEPYLTRARQAGADVVFTKPVEWARILEWLDKPDLAASA
Ga0299913_1077059313300031229SoilRVIAVTGYGEPYLSRARQAGAEVVFTKPVEWSRILEWLETPELAASA
Ga0307408_10038743933300031548RhizosphereRVLVVTGYGEPYLTRAKQAGAQVVFTKPVEWSRILEALQRPDLAASA
Ga0307408_10131903433300031548RhizosphereRIIVVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLERPGLAASA
Ga0310813_1005323413300031716SoilHHARIVVITGYGEPYLTRARRAGADVVLTKPVEWKRVLAALQPPGLAASA
Ga0307469_1246006913300031720Hardwood Forest SoilGEPYLSRARQAGADAVFTKPVEWTQILDCIRRPDLAASA
Ga0307405_1121254213300031731RhizosphereRHILATARGRTRVIVVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLERPDLAASA
Ga0307473_1029087313300031820Hardwood Forest SoilEPFLTRARQAGADVVFTKPVEWSRILEYIERSDLAASA
Ga0307413_1090664113300031824RhizospherePYLTRAKQAGAQVVFTKPVEWSRILEALQRPDLAASA
Ga0310884_1106124123300031944SoilLSSTRRRARVIVVTGYGEPYLTRARQAGADVVFTKPVEWAQVLESLDKPDLAASA
Ga0307409_10205637013300031995RhizosphereVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLERPGLAASA
Ga0310903_1015768613300032000SoilTARGRTRVIVVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLERPGLAASA
Ga0310897_1011256013300032003SoilRVIVVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLERPGLAASA
Ga0310899_1021868023300032017SoilTGYGEPYLTRARQAGADVVFTKPVEWAQVLEAIDKPDLAASA
Ga0310890_1153776713300032075SoilGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLERPGLAASA
Ga0307415_10038085133300032126RhizosphereRVLVVTGYGEPYLSRAKQAGAQVVFTKPVEWSRILEALQRPDLAASA
Ga0247830_1000500563300033551SoilQILSTARGRTRVIVVTGYGEPYLSRARQAGAEVVFTKPVEWTRILEWLDHPGLAASA
Ga0247830_1011441413300033551SoilTRVIVVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLEKPGLAASA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.