Basic Information | |
---|---|
Family ID | F104925 |
Family Type | Metagenome |
Number of Sequences | 100 |
Average Sequence Length | 43 residues |
Representative Sequence | LLVPGDHFGLPNHIRFGFGEELHHFQEALAETERGLKRVFTD |
Number of Associated Samples | 89 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.00 % |
% of genes near scaffold ends (potentially truncated) | 99.00 % |
% of genes from short scaffolds (< 2000 bps) | 85.00 % |
Associated GOLD sequencing projects | 82 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.43% β-sheet: 0.00% Coil/Unstructured: 68.57% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF02423 | OCD_Mu_crystall | 48.00 |
PF00171 | Aldedh | 25.00 |
PF01384 | PHO4 | 13.00 |
PF01865 | PhoU_div | 4.00 |
PF13520 | AA_permease_2 | 2.00 |
PF08309 | LVIVD | 1.00 |
PF01842 | ACT | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 48.00 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 25.00 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 25.00 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 25.00 |
COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 13.00 |
COG1392 | Phosphate transport regulator YkaA, distantly related to PhoU, UPF0111/DUF47 family | Inorganic ion transport and metabolism [P] | 4.00 |
COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.00 % |
Unclassified | root | N/A | 3.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002560|JGI25383J37093_10100571 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300004281|Ga0066397_10088455 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300005166|Ga0066674_10029468 | All Organisms → cellular organisms → Bacteria | 2419 | Open in IMG/M |
3300005174|Ga0066680_10210626 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300005177|Ga0066690_10077043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2099 | Open in IMG/M |
3300005178|Ga0066688_10163434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1400 | Open in IMG/M |
3300005178|Ga0066688_10538026 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300005406|Ga0070703_10402256 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300005436|Ga0070713_102265066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
3300005467|Ga0070706_101230707 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300005536|Ga0070697_100584939 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300005540|Ga0066697_10123938 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
3300005545|Ga0070695_100125946 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
3300005555|Ga0066692_10591895 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
3300005556|Ga0066707_10702138 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300005557|Ga0066704_10201438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1346 | Open in IMG/M |
3300005557|Ga0066704_10755890 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300005568|Ga0066703_10267444 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300006031|Ga0066651_10002805 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6289 | Open in IMG/M |
3300006032|Ga0066696_10549410 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300006755|Ga0079222_10842720 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300006791|Ga0066653_10714564 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
3300006847|Ga0075431_101573946 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300006854|Ga0075425_102744263 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300006854|Ga0075425_102864981 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300006865|Ga0073934_10225590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1251 | Open in IMG/M |
3300007258|Ga0099793_10582521 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300007265|Ga0099794_10433566 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300009012|Ga0066710_103253412 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 622 | Open in IMG/M |
3300009088|Ga0099830_11382822 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300009089|Ga0099828_11017929 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300009100|Ga0075418_12989127 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300009137|Ga0066709_101011504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1218 | Open in IMG/M |
3300009137|Ga0066709_102844594 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300009137|Ga0066709_103232723 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 594 | Open in IMG/M |
3300009156|Ga0111538_12605203 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300010301|Ga0134070_10166504 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 796 | Open in IMG/M |
3300010303|Ga0134082_10229985 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300010304|Ga0134088_10255138 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300010321|Ga0134067_10001045 | All Organisms → cellular organisms → Bacteria | 5970 | Open in IMG/M |
3300010322|Ga0134084_10094027 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300010362|Ga0126377_12558866 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300012200|Ga0137382_10438258 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300012203|Ga0137399_11009799 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300012206|Ga0137380_10685018 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300012208|Ga0137376_10027649 | All Organisms → cellular organisms → Bacteria | 4465 | Open in IMG/M |
3300012208|Ga0137376_10173760 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1859 | Open in IMG/M |
3300012208|Ga0137376_10393010 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300012208|Ga0137376_11325807 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300012209|Ga0137379_10234880 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
3300012210|Ga0137378_11882234 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300012211|Ga0137377_10072048 | All Organisms → cellular organisms → Bacteria | 3237 | Open in IMG/M |
3300012211|Ga0137377_10075282 | All Organisms → cellular organisms → Bacteria | 3167 | Open in IMG/M |
3300012285|Ga0137370_10023286 | All Organisms → cellular organisms → Bacteria | 3138 | Open in IMG/M |
3300012354|Ga0137366_10202765 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
3300012354|Ga0137366_10366417 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300012356|Ga0137371_10360524 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300012359|Ga0137385_11120684 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300012360|Ga0137375_10525517 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300012361|Ga0137360_10107115 | All Organisms → cellular organisms → Bacteria | 2151 | Open in IMG/M |
3300012944|Ga0137410_12104861 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300012972|Ga0134077_10114493 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300012977|Ga0134087_10002327 | All Organisms → cellular organisms → Bacteria | 5671 | Open in IMG/M |
3300014308|Ga0075354_1080290 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300015054|Ga0137420_1412690 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300015359|Ga0134085_10074977 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1380 | Open in IMG/M |
3300015359|Ga0134085_10542078 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300017656|Ga0134112_10473663 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300017657|Ga0134074_1256397 | Not Available | 630 | Open in IMG/M |
3300017659|Ga0134083_10541420 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300018060|Ga0187765_11166952 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 538 | Open in IMG/M |
3300018084|Ga0184629_10065745 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
3300018431|Ga0066655_10168156 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
3300018482|Ga0066669_10205006 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1514 | Open in IMG/M |
3300019789|Ga0137408_1301458 | Not Available | 912 | Open in IMG/M |
3300021363|Ga0193699_10493392 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300026285|Ga0209438_1003423 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 5359 | Open in IMG/M |
3300026300|Ga0209027_1251619 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300026307|Ga0209469_1150234 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300026313|Ga0209761_1106021 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1394 | Open in IMG/M |
3300026318|Ga0209471_1247782 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300026328|Ga0209802_1304898 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300026333|Ga0209158_1045720 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1814 | Open in IMG/M |
3300026527|Ga0209059_1171166 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300026528|Ga0209378_1256006 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300026529|Ga0209806_1251385 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300026532|Ga0209160_1239400 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 622 | Open in IMG/M |
3300026536|Ga0209058_1174188 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300027643|Ga0209076_1052058 | Not Available | 1159 | Open in IMG/M |
3300027646|Ga0209466_1085066 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300027903|Ga0209488_10931715 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300027948|Ga0209858_1029001 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 527 | Open in IMG/M |
3300028536|Ga0137415_11193723 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300028720|Ga0307317_10225077 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300031199|Ga0307495_10001741 | All Organisms → cellular organisms → Bacteria | 2309 | Open in IMG/M |
3300031547|Ga0310887_10909773 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300031820|Ga0307473_11235212 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300032205|Ga0307472_100032171 | All Organisms → cellular organisms → Bacteria | 3058 | Open in IMG/M |
3300033412|Ga0310810_10046543 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 5294 | Open in IMG/M |
3300033417|Ga0214471_10079945 | All Organisms → cellular organisms → Bacteria | 2680 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.00% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.00% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.00% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.00% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.00% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027948 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25383J37093_101005711 | 3300002560 | Grasslands Soil | AEHSVLLVPGEHFGLPQHIRFGYGEELQHLQEALAETERALRRVFAD* |
Ga0066397_100884552 | 3300004281 | Tropical Forest Soil | SVLLCPGEHFGMPGFLRFGYGGELQHFQEALAETERGLRCLFSD* |
Ga0066674_100294681 | 3300005166 | Soil | HDVLLVPGDHFGLPNHIRFGFGEELHHFREALAETERGLKRAFAD* |
Ga0066680_102106263 | 3300005174 | Soil | PGDHFGLPNHLRFGYGEELHHLKDALAETERGLRRVFTD* |
Ga0066690_100770431 | 3300005177 | Soil | VRAEHSVLLVPGEHFGLPNHIRFGYGEELHHFQEALAETERGLKRVFAD* |
Ga0066688_101634341 | 3300005178 | Soil | VRAEHGVLLVPGDHFGLPNHIRFGYGEELHHFQEALAETERGLKRVLAD* |
Ga0066688_105380262 | 3300005178 | Soil | GVLLCPGDHFGMPGFLRFGFGGDLQHFQEALAETERGLRRLFSD* |
Ga0070703_104022561 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | PGDHFGMPGFLRFGYGGELQQFQEALAETERGLRRLFSD* |
Ga0070713_1022650662 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LVPGEHFGLPHYLRLGFGEELHHFREALGETERGLKRAFAD* |
Ga0070706_1012307071 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DHSVLLVPGDHFGLPNHIRFGFGEELEHFQEALAETERGLKRVFAD* |
Ga0070697_1005849391 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | QHSVLLCPGDHFGMPGFLRFGYGGELQHFQEALAETERGLRRLFSD* |
Ga0066697_101239383 | 3300005540 | Soil | DHFGLPHHIRFGFGEEVHQFEAALAETERGLKRVFTD* |
Ga0070695_1001259463 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | SVLLCPGDHFGMPGFLRFGYGGELQHFQEALAETERGLRRLFTD* |
Ga0066692_105918951 | 3300005555 | Soil | PGDHFGLPNHIRFGFGEELHHFREALAETERGLKRVFAD* |
Ga0066707_107021382 | 3300005556 | Soil | LRAEHSVLLVPGEHFGVPGHLRFGYGEELQHFQEALAETERGLKRMFAD* |
Ga0066704_102014381 | 3300005557 | Soil | AEYSVLLVPGEHFGVPGHLRFGYGDELQHFQQALAETARGLKRIFTD* |
Ga0066704_107558902 | 3300005557 | Soil | PGEHFGLPHHIRFGYGEELQHLQEALAETERALRRVFAD* |
Ga0066703_102674441 | 3300005568 | Soil | HSVLLVPGDHFGLPNHIRFGFGDELHHFREALAETERGLKRVFAD* |
Ga0066651_100028057 | 3300006031 | Soil | GDHFGLPRHIRFGFGEELHHFEAALAETERGLKRVFTD* |
Ga0066696_105494102 | 3300006032 | Soil | AEYDVLLVPGDHFGLPNHLRFGYGEELHHFKDALAETERGLRRVFTD* |
Ga0079222_108427202 | 3300006755 | Agricultural Soil | AQHSVLLCPGDHFGMPGFLRFGYGGELQHFQEALAETERGLRRLFTD* |
Ga0066653_107145641 | 3300006791 | Soil | RGAIPAPDVVEKLRAQHSVLLCAGDHFGMPGFLRFGFGDELQHFQEALAETERGLRRLFSD* |
Ga0075431_1015739462 | 3300006847 | Populus Rhizosphere | RAQHSVLLCPGDHFGSPGFLRFGYGDELSHFQEALAETERGLRRLFSD* |
Ga0075425_1027442632 | 3300006854 | Populus Rhizosphere | GDHFGMPGFLRFGYGGELQHFQEALAESERGLRRLFSD* |
Ga0075425_1028649812 | 3300006854 | Populus Rhizosphere | VLLVPGDHFGLPNHIRFGFGEELQHFREALAETERGLKRVFAD* |
Ga0073934_102255903 | 3300006865 | Hot Spring Sediment | FELPHHLRFGYGQALAGLQAALAETERGLRRVFAD* |
Ga0099793_105825211 | 3300007258 | Vadose Zone Soil | EHFGLPQHIRFGYGNELSELQAALAETEHGLKRLFTD* |
Ga0099794_104335662 | 3300007265 | Vadose Zone Soil | LVPGDHFGLPNHIRFGFGEELHHFREALAETERGLKRVFAD* |
Ga0066710_1032534122 | 3300009012 | Grasslands Soil | RAEHSVLLVPGEHFGVPGHLRFGYGDELQHFQEALAETERGLKRIFAD |
Ga0099830_113828221 | 3300009088 | Vadose Zone Soil | GLPNHIRFGFGEELHHFREALAETERGLKRVFAD* |
Ga0099828_110179291 | 3300009089 | Vadose Zone Soil | GVLLVPGDHFGLPNHIRFGYGEELHHFQEALAETERGLKRVLAD* |
Ga0075418_129891272 | 3300009100 | Populus Rhizosphere | LLVPGDQFGMPSYIRFGFGGDMQHFQEALAETERGLRRLFTD* |
Ga0066709_1010115043 | 3300009137 | Grasslands Soil | GLPNHIRFGYGEELHHFQEALAETERGLKRVFAD* |
Ga0066709_1028445941 | 3300009137 | Grasslands Soil | GLPNHLRFGYGEELQHLQEALAETERGLRRVFAD* |
Ga0066709_1032327232 | 3300009137 | Grasslands Soil | VLLVPGEHFGVPGHLRFGYGDELQHFQEALAETERGLKRIFAD* |
Ga0111538_126052031 | 3300009156 | Populus Rhizosphere | QHSVLLVPGEHFGMPSYLRFGFGDDLQHFQEALAETERALRRLFTD* |
Ga0134070_101665041 | 3300010301 | Grasslands Soil | PGDHFGMPGFLRFGYGEDLKHLQEALAETERGLRRLFTD* |
Ga0134082_102299852 | 3300010303 | Grasslands Soil | LVPGDHFGLPNHLRFGYGEELHHLKDALAETERGLRRVFTD* |
Ga0134088_102551381 | 3300010304 | Grasslands Soil | HSVLLVPGDHFGLPNHIRFGFGEELHHFREALAETERGLKRVFAD* |
Ga0134067_100010457 | 3300010321 | Grasslands Soil | VPGDHFGLPNHIRFGFGEELPHFQEALAETERGLKRVFAD* |
Ga0134084_100940272 | 3300010322 | Grasslands Soil | GLPHHIRFGFGEELHHFEAALAETERGLKRVFTD* |
Ga0126377_125588662 | 3300010362 | Tropical Forest Soil | EKLRAQHSVLLCPGEHFGMPGFLRFGYGGELQHFQEALAETERGLRRLFSD* |
Ga0137382_104382582 | 3300012200 | Vadose Zone Soil | QHGVLLCPGDHFGMPGFLRFGYGGELQHFQEALAETERGLRRLFSD* |
Ga0137399_110097991 | 3300012203 | Vadose Zone Soil | FGLPHHIRFGFGEELHHFREALAETERGLKRVFAD* |
Ga0137380_106850182 | 3300012206 | Vadose Zone Soil | VLLVPGDHFGLPNHIRFGFGEELHHFREALAETERGLKRVFAD* |
Ga0137376_100276496 | 3300012208 | Vadose Zone Soil | FGLPNHIRFGYGEELHHFQEALAETERGLKRVFAD* |
Ga0137376_101737601 | 3300012208 | Vadose Zone Soil | SVLLCPGDHFGTPGFLRLGFGGELQHFQEALAETERGLRRLFSD* |
Ga0137376_103930102 | 3300012208 | Vadose Zone Soil | DHFGMPGFLRFGFGGELQHFQEALAETERGLRRLFAD* |
Ga0137376_113258071 | 3300012208 | Vadose Zone Soil | RAEHGVLLVPGDHFGLPRHIRFGFGEELHHFEAALAETERGLKRVFTD* |
Ga0137379_102348803 | 3300012209 | Vadose Zone Soil | LLCPGDHFGMPGFLRFGFGGELQHFQEALAETERGLRRLFTD* |
Ga0137378_118822341 | 3300012210 | Vadose Zone Soil | GDHFGMPHHIRFGFGEELHHLQEALAETERGLKRVFID* |
Ga0137377_100720485 | 3300012211 | Vadose Zone Soil | AEHNVLLVPGDHFGLPNHIRFGFGEELHHFREALAETERGLKRVFAD* |
Ga0137377_100752824 | 3300012211 | Vadose Zone Soil | VLLVPGEHFGLPQHIRFGFGEELHHFEAALAETERGLKRVFTD* |
Ga0137370_100232864 | 3300012285 | Vadose Zone Soil | CPGDHFGMPGFLRFGFGGELQHFQEALAETERGLRRLFAD* |
Ga0137366_102027651 | 3300012354 | Vadose Zone Soil | VLLCPGDHFGMPGFLRFGYGGELQHFQEALAETERGLRRLFSD* |
Ga0137366_103664172 | 3300012354 | Vadose Zone Soil | LLVPGDHFGLPNHIRFGFGEELHHFQEALAETERGLKRVFTD* |
Ga0137371_103605241 | 3300012356 | Vadose Zone Soil | EHSVLLCPGEHFGLPGYLRFGYGNELSELQEALAETERGLKRVLAD* |
Ga0137385_111206841 | 3300012359 | Vadose Zone Soil | SVLLVPGDHFGLPRHLRLGFGEELHHFREALGETERGLKRAFAD* |
Ga0137375_105255172 | 3300012360 | Vadose Zone Soil | DHFGLPNYIRFGYGEELHHLQEALAETERGVKQVFAD* |
Ga0137360_101071151 | 3300012361 | Vadose Zone Soil | SVLLCPGDHFGMPGFLRFGYGEDLQHFQEALAETERGLRRLFSD* |
Ga0137410_121048612 | 3300012944 | Vadose Zone Soil | FGMPHHLRFGFGNELAVLQAALGETERGLRRVMTD* |
Ga0134077_101144932 | 3300012972 | Grasslands Soil | VLLVPGDHFGLPNHIRFGFGEELGHFQEALAETERGLKRAFAD* |
Ga0134087_100023271 | 3300012977 | Grasslands Soil | RMRAEHSVLLVPGEHFGLPNHIRFGYGEELHHLQEALAETERGLKRVFAD* |
Ga0075354_10802902 | 3300014308 | Natural And Restored Wetlands | EHDVLLVSGEHFGMPGYIRFGIGGDPAELAAALAETERGLRRLFSD* |
Ga0137420_14126902 | 3300015054 | Vadose Zone Soil | VPGDHFGLPNHIRFGFGEELHHFREALAETERGLKRVFAD* |
Ga0134085_100749771 | 3300015359 | Grasslands Soil | SVLLVPGEHFGLPNHLRFGYGEELQHLQEALAETERALRRVFAD* |
Ga0134085_105420781 | 3300015359 | Grasslands Soil | EHSVLLVPGEHFGLPNHLRFGYGEELQHLQEALAETERGLRRVFAD* |
Ga0134112_104736631 | 3300017656 | Grasslands Soil | EHSVLLVPGDHFGLPNHIRFGVGEELDHFQEALAETERGLKRVFTD |
Ga0134074_12563972 | 3300017657 | Grasslands Soil | MRAEHDVLLVPGEHFGLPNHIRFGFGEELHHFQKALAETERGLKRVFTD |
Ga0134083_105414201 | 3300017659 | Grasslands Soil | KMRADHSVLLVPGDHFGLPNHIRFGFGEELRHFQEALAETERGLKRVFAD |
Ga0187765_111669522 | 3300018060 | Tropical Peatland | VPGDHFGAPGYLRFGYGGELEHLRQGLAETEKGLREMFTHPD |
Ga0184629_100657451 | 3300018084 | Groundwater Sediment | RAQHSVLLCPGDHFGTPGFLRFGYGGELKQFQDALAETERGLRRLFSD |
Ga0066655_101681562 | 3300018431 | Grasslands Soil | GANRRAPPGVLRGPGGHCGMPGFLRFGYGGELQHFQEALAETERGLRRLFTD |
Ga0066669_102050061 | 3300018482 | Grasslands Soil | LCPGDHFGMPGFLRFGYGDELQHFQEALAETERGLRRLFSD |
Ga0137408_13014581 | 3300019789 | Vadose Zone Soil | FGTPGFLRLRFGFGGELQHFQEALAETERGLRRLFSD |
Ga0193699_104933922 | 3300021363 | Soil | HSVLLVPGEHFGMPGYLRFGYGEGLQHLQEALAETERGLKRLFS |
Ga0209438_10034237 | 3300026285 | Grasslands Soil | GDHFGAPGFLRFGFGGELQHFQEALAETERGLRRLFSD |
Ga0209027_12516191 | 3300026300 | Grasslands Soil | EHSVLLCPGEHFGLPGYLRFGYGNELSELQAALAETERGLKRLLGD |
Ga0209469_11502342 | 3300026307 | Soil | PGDHFGLPNHIRFGFGEELHHFREALAETERGLKRVFAD |
Ga0209761_11060211 | 3300026313 | Grasslands Soil | VPGEHFGLPQHIRFGYGEELQHLQEALAETERALRRVFAD |
Ga0209471_12477822 | 3300026318 | Soil | DHFGLPHHIRFGFGEEVRHFEAALAETERGLKRVFTD |
Ga0209802_13048982 | 3300026328 | Soil | AEYDVLLVPGDHFGLPNHLRLGYGEELHHLKDALAETERGLRRVFTD |
Ga0209158_10457203 | 3300026333 | Soil | AEHSVLLVPGEHFGLPQHIRFGYGEELQHLQEALAETERALRRVFAD |
Ga0209059_11711662 | 3300026527 | Soil | PGDHFGLPRHIRFGFGEELHHFEAALAETERGLKRVFTD |
Ga0209378_12560062 | 3300026528 | Soil | CPGDHFGMPGFLRFGYGGELQHFQEALAETERGLRRLFTD |
Ga0209806_12513852 | 3300026529 | Soil | QHGVLLCPGDHFGMPGFLRFGFGGDLQHFQEALAETERGLRRLFSD |
Ga0209160_12394002 | 3300026532 | Soil | LLVQGEHFGVPGHLRFGYGDELQHFQQALAETARGLKRIFTD |
Ga0209058_11741881 | 3300026536 | Soil | KMRANHSVLLVPGDHFGLPNHIRFGFGEELRHFQEALAETERGLKRVFAD |
Ga0209076_10520582 | 3300027643 | Vadose Zone Soil | FGMPGFLRFGFGGELQHFQEALAETERGLRRLFSD |
Ga0209466_10850662 | 3300027646 | Tropical Forest Soil | SVLLCPGEHFGMPGFLRFGYGGELQHFQEALAETERGLRCLFSD |
Ga0209488_109317152 | 3300027903 | Vadose Zone Soil | DQFGMPSFLRFGFGGDLQHFEEALAETERALRRLFTD |
Ga0209858_10290012 | 3300027948 | Groundwater Sand | DHFGTPGFLRFGYGGELKHFQEALAETERGLRRLFSD |
Ga0137415_111937231 | 3300028536 | Vadose Zone Soil | FGMPGFLRFGFGSELQHFQEALAETERGLRRLFSD |
Ga0307317_102250772 | 3300028720 | Soil | VRAQHSVLLVPGEHFGMPSFLRFGFGDALQHFQEALAETERALRRLFTD |
Ga0307495_100017414 | 3300031199 | Soil | CAGDHFGMPGFLRFGFGDELQHFQEALAETERGLRRLFSD |
Ga0310887_109097731 | 3300031547 | Soil | VLLVPGEHFGMPNYLRIGYGDELQHLQEALAETERGLKRILT |
Ga0307473_112352121 | 3300031820 | Hardwood Forest Soil | SVLLCPGEHFGMPGFLRFGFGGELQHFQEALAETERGLRRLFSD |
Ga0307472_1000321715 | 3300032205 | Hardwood Forest Soil | AEHSVLLVPGDHFGLPYHLRLGFGEELRHFREALGETERGLKRAFAD |
Ga0310810_100465431 | 3300033412 | Soil | CPGDHFGMPGFLRFGFGDELKHFQEALAETERGLRRLFSD |
Ga0214471_100799451 | 3300033417 | Soil | VLLVPGDHFGMPGFLRFGFGGELQHFQEALAETERGLRRLFSD |
⦗Top⦘ |