NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F104826

Metagenome Family F104826

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F104826
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 44 residues
Representative Sequence EALVAQGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE
Number of Associated Samples 89
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.00 %
% of genes from short scaffolds (< 2000 bps) 91.00 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (66.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(18.000 % of family members)
Environment Ontology (ENVO) Unclassified
(25.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 36.23%    β-sheet: 0.00%    Coil/Unstructured: 63.77%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF03401TctC 16.00
PF01436NHL 11.00
PF02775TPP_enzyme_C 3.00
PF07494Reg_prop 2.00
PF01970TctA 1.00
PF09351DUF1993 1.00
PF07331TctB 1.00
PF14534DUF4440 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 16.00
COG3292Periplasmic ligand-binding sensor domainSignal transduction mechanisms [T] 2.00
COG1784TctA family transporterGeneral function prediction only [R] 1.00
COG3333TctA family transporterGeneral function prediction only [R] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms66.00 %
UnclassifiedrootN/A34.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000793|AF_2010_repII_A001DRAFT_10128689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales528Open in IMG/M
3300005167|Ga0066672_10588868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium721Open in IMG/M
3300005178|Ga0066688_10447324All Organisms → cellular organisms → Bacteria → Proteobacteria836Open in IMG/M
3300005181|Ga0066678_10036927All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2708Open in IMG/M
3300005331|Ga0070670_101473232All Organisms → cellular organisms → Bacteria → Proteobacteria625Open in IMG/M
3300005332|Ga0066388_105309028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum653Open in IMG/M
3300005332|Ga0066388_105608278All Organisms → cellular organisms → Bacteria → Proteobacteria635Open in IMG/M
3300005337|Ga0070682_100284935All Organisms → cellular organisms → Bacteria → Proteobacteria1206Open in IMG/M
3300005406|Ga0070703_10521183All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Advenella → Advenella kashmirensis538Open in IMG/M
3300005436|Ga0070713_102249210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales528Open in IMG/M
3300005467|Ga0070706_100212907All Organisms → cellular organisms → Bacteria → Proteobacteria1804Open in IMG/M
3300005540|Ga0066697_10232547All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1094Open in IMG/M
3300005559|Ga0066700_10965707All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter xylosoxidans562Open in IMG/M
3300005713|Ga0066905_101127300All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300005713|Ga0066905_101695381All Organisms → cellular organisms → Bacteria → Proteobacteria580Open in IMG/M
3300005713|Ga0066905_101726452All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300005713|Ga0066905_102179155All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300005719|Ga0068861_100167441All Organisms → cellular organisms → Bacteria → Proteobacteria1818Open in IMG/M
3300005764|Ga0066903_104805670All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria718Open in IMG/M
3300005983|Ga0081540_1276085All Organisms → cellular organisms → Bacteria → Proteobacteria581Open in IMG/M
3300006028|Ga0070717_10961841All Organisms → cellular organisms → Bacteria → Proteobacteria778Open in IMG/M
3300006034|Ga0066656_10045358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2517Open in IMG/M
3300006038|Ga0075365_10397960All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales972Open in IMG/M
3300006796|Ga0066665_11433688Not Available536Open in IMG/M
3300006844|Ga0075428_101926630All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales614Open in IMG/M
3300006845|Ga0075421_101319332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales798Open in IMG/M
3300006845|Ga0075421_102062318All Organisms → cellular organisms → Bacteria → Proteobacteria606Open in IMG/M
3300006852|Ga0075433_11107380All Organisms → cellular organisms → Bacteria → Proteobacteria688Open in IMG/M
3300007788|Ga0099795_10337606All Organisms → cellular organisms → Bacteria → Proteobacteria671Open in IMG/M
3300009088|Ga0099830_10189165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1605Open in IMG/M
3300009137|Ga0066709_100404426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1895Open in IMG/M
3300009147|Ga0114129_13087502Not Available545Open in IMG/M
3300009162|Ga0075423_12602541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria553Open in IMG/M
3300010046|Ga0126384_10228069Not Available1492Open in IMG/M
3300010047|Ga0126382_10137392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia birgiae1652Open in IMG/M
3300010047|Ga0126382_10971845Not Available741Open in IMG/M
3300010047|Ga0126382_11540140Not Available613Open in IMG/M
3300010048|Ga0126373_10429088All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1352Open in IMG/M
3300010360|Ga0126372_10831168All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300010366|Ga0126379_11433173All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300010373|Ga0134128_10767883Not Available1069Open in IMG/M
3300010398|Ga0126383_12243919All Organisms → cellular organisms → Bacteria → Proteobacteria632Open in IMG/M
3300011270|Ga0137391_11343029Not Available561Open in IMG/M
3300012363|Ga0137390_11116401All Organisms → cellular organisms → Bacteria → Proteobacteria737Open in IMG/M
3300012917|Ga0137395_10427096All Organisms → cellular organisms → Bacteria → Proteobacteria950Open in IMG/M
3300012929|Ga0137404_11960901Not Available546Open in IMG/M
3300012930|Ga0137407_10605972Not Available1028Open in IMG/M
3300012930|Ga0137407_11758388All Organisms → cellular organisms → Bacteria → Proteobacteria591Open in IMG/M
3300012939|Ga0162650_100005293Not Available1504Open in IMG/M
3300012961|Ga0164302_11046640Not Available640Open in IMG/M
3300012971|Ga0126369_10132769All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2313Open in IMG/M
3300012971|Ga0126369_12507006Not Available601Open in IMG/M
3300014166|Ga0134079_10457902All Organisms → cellular organisms → Bacteria → Proteobacteria606Open in IMG/M
3300015201|Ga0173478_10567170Not Available583Open in IMG/M
3300016319|Ga0182033_11473436Not Available614Open in IMG/M
3300016371|Ga0182034_11106231All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300016371|Ga0182034_12061475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria504Open in IMG/M
3300016404|Ga0182037_10737492All Organisms → cellular organisms → Bacteria → Proteobacteria845Open in IMG/M
3300018031|Ga0184634_10460834Not Available572Open in IMG/M
3300018081|Ga0184625_10424866Not Available683Open in IMG/M
3300021510|Ga0222621_1040783Not Available965Open in IMG/M
3300021560|Ga0126371_11360263All Organisms → cellular organisms → Bacteria → Proteobacteria842Open in IMG/M
3300025919|Ga0207657_10107048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2313Open in IMG/M
3300025928|Ga0207700_11615315Not Available573Open in IMG/M
3300026557|Ga0179587_10848354All Organisms → cellular organisms → Bacteria → Proteobacteria602Open in IMG/M
3300027903|Ga0209488_10185955Not Available1567Open in IMG/M
3300027907|Ga0207428_10118428All Organisms → cellular organisms → Bacteria → Proteobacteria2032Open in IMG/M
3300027909|Ga0209382_11649379Not Available632Open in IMG/M
3300028704|Ga0307321_1012221Not Available1459Open in IMG/M
3300028768|Ga0307280_10398223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum513Open in IMG/M
3300028802|Ga0307503_10015590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2378Open in IMG/M
3300028828|Ga0307312_10444965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium853Open in IMG/M
3300028872|Ga0307314_10111691Not Available756Open in IMG/M
3300028880|Ga0307300_10269703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum569Open in IMG/M
3300028884|Ga0307308_10516250All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_62_17573Open in IMG/M
3300031170|Ga0307498_10032256Not Available1299Open in IMG/M
3300031231|Ga0170824_109653560Not Available1402Open in IMG/M
3300031545|Ga0318541_10085681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1672Open in IMG/M
3300031545|Ga0318541_10172840All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1191Open in IMG/M
3300031546|Ga0318538_10545889Not Available629Open in IMG/M
3300031549|Ga0318571_10455711Not Available508Open in IMG/M
3300031561|Ga0318528_10657131Not Available561Open in IMG/M
3300031680|Ga0318574_10376994All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300031713|Ga0318496_10722809Not Available549Open in IMG/M
3300031719|Ga0306917_11107311All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300031740|Ga0307468_101235304Not Available676Open in IMG/M
3300031769|Ga0318526_10417021All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_62_17549Open in IMG/M
3300031779|Ga0318566_10012983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3523Open in IMG/M
3300031805|Ga0318497_10557988Not Available642Open in IMG/M
3300031859|Ga0318527_10086714All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1273Open in IMG/M
3300031879|Ga0306919_11019600All Organisms → cellular organisms → Bacteria → Proteobacteria632Open in IMG/M
3300031893|Ga0318536_10524669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum594Open in IMG/M
3300031912|Ga0306921_11531716All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300031946|Ga0310910_10665214All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300032013|Ga0310906_10654393Not Available729Open in IMG/M
3300032054|Ga0318570_10061798Not Available1578Open in IMG/M
3300032055|Ga0318575_10001350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium7151Open in IMG/M
3300032059|Ga0318533_10057068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2612Open in IMG/M
3300032089|Ga0318525_10377530Not Available727Open in IMG/M
3300033290|Ga0318519_10774775Not Available589Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil7.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.00%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.00%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012939Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A001DRAFT_1012868933300000793Forest SoilGMEGEPGPPAAVSERIRSDIRKWREVAASAGIHAE*
Ga0066672_1058886813300005167SoilALIAQGMTAEAGAPDTVTQRIRDDIAKWRDVAAKAGIRPE*
Ga0066688_1044732413300005178SoilLESSDGTEALVAQGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE*
Ga0066678_1003692743300005181SoilDVLESSDGTEALVAQGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE*
Ga0070670_10147323213300005331Switchgrass RhizosphereEALIAQGMAPEPGPPETVTERTRTDIEKWRGVVAKAGIRAE*
Ga0066388_10530902823300005332Tropical Forest SoilKAALVAQGMEGEPGPPAAVSERIRNDIRKCREVAASAGIHAE*
Ga0066388_10560827813300005332Tropical Forest SoilREMNEILASAEGKEALVAQGMEGEPGPPEAVTERIRGDIRKWRDVAATAGIRAE*
Ga0070682_10028493523300005337Corn RhizosphereEAMIAQGMAPEPGPPQAVTERTRTDIEKWRCVVAKAGIRAE*
Ga0070703_1052118313300005406Corn, Switchgrass And Miscanthus RhizosphereLVAQGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE*
Ga0070713_10224921023300005436Corn, Switchgrass And Miscanthus RhizosphereEAMIAQGMAPEPGRPDAVTARIRADIEKWRAVVTKAGIRPE*
Ga0070706_10021290733300005467Corn, Switchgrass And Miscanthus RhizosphereSSDGTEALVAQGMAPEPGPPEALTERIRGDIEKWRGVAVKAGIRAE*
Ga0066697_1023254713300005540SoilDGTQALLAQGMTPEAGPPEALTQRIRIDIEKWRDVAAKAGIRPE*
Ga0066700_1096570713300005559SoilESSDGTEALVAQGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE*
Ga0066905_10112730023300005713Tropical Forest SoilGRDALVAQGVDTEIGTPQAVTEHIRADIEKWRGVVAKAGIKAQ*
Ga0066905_10169538113300005713Tropical Forest SoilGTEALVAQGMAAEPGPPEALTERIRGDIEKWRGVAVKAGIRLQ*
Ga0066905_10172645213300005713Tropical Forest SoilQGLESEPGPPDAVSARIRSDIQKWRDVAAKAGIRAE*
Ga0066905_10217915523300005713Tropical Forest SoilASAEGKEALVAQGMEGEPGPPEAVSERIRADIQKWRDVAAKAGIRAE*
Ga0068861_10016744133300005719Switchgrass RhizosphereAMIAQGMAPEPGPPEAVTERTRTDIEKWRGVVAKAGIRAE*
Ga0066903_10480567013300005764Tropical Forest SoilQGMEGEPGPPAAVSERIRSDIRKWREVAASAGIHAE*
Ga0081540_127608523300005983Tabebuia Heterophylla RhizosphereLESEPGPADAVSARIRTDIQKWRDVAAKAGIRAE*
Ga0070717_1096184113300006028Corn, Switchgrass And Miscanthus RhizosphereAEGKEAMIAQGMAPEPGPPQAVTERTRTDIEKWHGVVAKAGIRAE*
Ga0066656_1004535813300006034SoilGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE*
Ga0075365_1039796013300006038Populus EndosphereVAQGMEGEPGPPEAVSERIRADIHKWREVAAKAGIRAE*
Ga0066665_1143368823300006796SoilNEILKSTDGTEALVAQGMAAEPGPPEALTERIRGDIEKWRGVAVKAGIRPE*
Ga0075428_10192663013300006844Populus RhizosphereALTAQGLESEPGPSDAVSARIRDDIAKWRDVAAKAGIRAE*
Ga0075421_10131933223300006845Populus RhizosphereQGMAPEPGRPDAVTARIRADIEKWRAVVTKAGIRPE*
Ga0075421_10206231813300006845Populus RhizosphereVAQGMEPETGPPQAVTDRIRVDIEKWRGVVAKAGIRAE*
Ga0075433_1110738023300006852Populus RhizosphereVAQGMAPEPGPPEALTERIRGDIEKWRGVAVKAGIRSE*
Ga0099795_1033760633300007788Vadose Zone SoilLVAQGLEAEPGPPQAVTERIRSDTAKWRGVVAKAGIKAE*
Ga0099830_1018916533300009088Vadose Zone SoilGKEALVAQGMEPEPGPPAALTERIRTDIEKWRGVVAKAGIRAE*
Ga0066709_10040442613300009137Grasslands SoilNEILNSPDGTQALLAQGMTPEAGPPEALTQRIRTDIEKWRDVAAKAGIRPE*
Ga0114129_1308750213300009147Populus RhizosphereMNDILASAEGKEALVAQGMEGEPGPPEAVSERIRNDIQKWRDVAAKAGIRAE*
Ga0075423_1260254123300009162Populus RhizosphereLVAQGMETEPGPPEAVTERIRADIEKWRALVAKAGIKPE*
Ga0126384_1022806913300010046Tropical Forest SoilLVAQGMEGEPGPPEAVTERIRGDIRKWRDVAATAGIRAE*
Ga0126382_1013739213300010047Tropical Forest SoilAEGKEALVAQGMEGEPGPPEAVSERIRADIHKWREVAAKAGIRAE*
Ga0126382_1097184523300010047Tropical Forest SoilREVNDILNSTEGTEALVAQGMVAEPGPPEALTESIRGDIEKWRGVAVKAGIRPE*
Ga0126382_1154014023300010047Tropical Forest SoilLASAEGKEALVAQGMEGEPGPPEAVTERIRGDIRKWRDVAATAGIRAE*
Ga0126373_1042908853300010048Tropical Forest SoilMMPEPGPPEALTERIRADIGKWRDVATKAGIRAE*
Ga0126372_1083116813300010360Tropical Forest SoilALVAQGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE*
Ga0126379_1143317323300010366Tropical Forest SoilAQGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRPQ*
Ga0134128_1076788313300010373Terrestrial SoilMIAQGMAPEPGPPEAVTERTRTDIEKWRGVVAKAGIRAE*
Ga0126383_1224391913300010398Tropical Forest SoilNEILGSADGKAALVAQGMEGEPGPPAAVSERIRSDIRKWGEVAASAGIRAE*
Ga0137391_1134302923300011270Vadose Zone SoilGVEPEPGPPAALTERIRTDIEKWRGVVAKAGIRSE*
Ga0137390_1111640113300012363Vadose Zone SoilTQALIDQGMTPGPCPPEALTQRIREDITKWREVAAKAGIRAE*
Ga0137395_1042709613300012917Vadose Zone SoilVNDILESSDGTEALVAQGMAPEPGPPEELTERIRGDIEKWRGVAAKAGIRSE*
Ga0137404_1196090113300012929Vadose Zone SoilNREVNEILRSTDGTEALVAQGRTAEPGPPEALTERIRGDIEKWRGVAAKARIRSE*
Ga0137407_1060597223300012930Vadose Zone SoilGTEALIAQGMTAEAGAPEAVTQRIRDDIAKWRDVAAKAGIRVE*
Ga0137407_1175838823300012930Vadose Zone SoilGTEALIAQGMTAEAGAPEAVTQRIRDDIAKWRDVAAKAGIRPE*
Ga0162650_10000529313300012939SoilAMIAQGMAPEPGPPSAVTERTRADIEKWRGVVAKAGIRAE*
Ga0164302_1104664013300012961SoilALIAQGMAPEPGPPETVTERTRTDIEKWRGVVAKAGIRAE*
Ga0126369_1013276933300012971Tropical Forest SoilDATEALIAQGMTAEPGPPDALTQRIRTDTSKWRDVAAKAGIRAE*
Ga0126369_1250700623300012971Tropical Forest SoilEALVAQGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE*
Ga0134079_1045790213300014166Grasslands SoilTQALFAQGMTPEAGPPEALTQRIRTDIEKWRDIAAKAGIRPE*
Ga0173478_1056717023300015201SoilGNEAMIAQGMAPEPGRPDAVTARIRTDIEKWRAVVTKAGIRPE*
Ga0182033_1147343623300016319SoilVNDILKSTEGTEALVAQGMVAEPGPPEALTERIRGDLEKWRGVAVKAGIRAE
Ga0182034_1110623123300016371SoilALVAQGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE
Ga0182034_1206147523300016371SoilVLESSDGTEALVAQGMAPEPGSPEALTQRIRGDIEKWRGVAAKAGIRSE
Ga0182037_1073749223300016404SoilVAQGMAPEPGPPEALTERIRGDIEKWRGVAARAGIRPQ
Ga0184634_1046083413300018031Groundwater SedimentVAQGVEPEGGPPEAVTERIRGDIDKWRGVVAKAGIRAE
Ga0184625_1042486613300018081Groundwater SedimentILDTAEGKEAMIAQGMAPEPGPPEAVTERTRTDIEKWRGVVAKAGIRAE
Ga0222621_104078313300021510Groundwater SedimentAEGKEAMIAQGMAPEPGTPEAVTERTRTDIEKWRGVVAKAGIRAE
Ga0126371_1136026313300021560Tropical Forest SoilDILNSADATEALIAQGMTAEPGPPDALTQRIRTDTSKWRDVAAKAGIRAE
Ga0207657_1010704813300025919Corn RhizosphereDTADGKEAMISQGMAPEPGPPEAVTERTRTDIEKWRGVVAKAGIRAE
Ga0207700_1161531513300025928Corn, Switchgrass And Miscanthus RhizosphereAAQGLESEPGPPEAVSARIRSDIQKWREVAAKAGIRAE
Ga0179587_1084835423300026557Vadose Zone SoilTQALIDQGMTPGPGPPEALTQRIREDITKWREVAANAGIRAE
Ga0209488_1018595513300027903Vadose Zone SoilTAEGKEAMIAQGMAPEPGTPEAVTERTRTDIEKWRGVVAKAGIRAE
Ga0207428_1011842853300027907Populus RhizosphereGMTAEAGAPEAVTQRIRDDIVKWRDVIAKAGIKPE
Ga0209382_1164937913300027909Populus RhizosphereDSAEGRDALVAQGMEPETGPPQAVTDRIRVDIEKWRGVVAKAGIRAE
Ga0307321_101222113300028704SoilNDILDTAEGKVAMIAQGMAPEPGPPAAVTERTRTDIEKWRGVVAKAGIRAE
Ga0307280_1039822313300028768SoilKEAMIAQGMTPEPGPPQTVTERTRSDIEKWRGVVAKAGIRAE
Ga0307503_1001559013300028802SoilAQGMAPEPGPPEAVTERTRTDIEKWRGVVAKAGIRAE
Ga0307312_1044496523300028828SoilAQGLEPDPGPPQAVTDRIRADTDKWRGVVAKAGIKAE
Ga0307314_1011169123300028872SoilKVAMIAQGMAPEPGPPAAVTERTRTDIEKWRGVVAKAGIRAE
Ga0307300_1026970313300028880SoilEVNEILDTAEGKEAMIAQGMTPEPGPPQAVTERTRSDIEKWRGVVAKAGIRAE
Ga0307308_1051625013300028884SoilAEGKEALVAQGLEPDPGPPQAVTDRIRADTDKWRGVVAKAGIKAE
Ga0307498_1003225613300031170SoilDTAEGKEALIAQGMAPEPGPPETVTERTRTDIEKWRGVVAKAGIRAE
Ga0170824_10965356013300031231Forest SoilKEAMIAQGMAPEPGPPQAVTERTRSDIEKWRGVVAKAGIRAE
Ga0318541_1008568133300031545SoilDVLESSDGTEALVAQGMAPEPGPPEALTERIRGDIEKWRGVAARAGIRPQ
Ga0318541_1017284013300031545SoilLVAQGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE
Ga0318538_1054588913300031546SoilDGTEALVAQGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE
Ga0318571_1045571113300031549SoilSDGTEALVAQGMAPEPGPPEALTERIRGDIAKWRGVAARAGIRPQ
Ga0318528_1065713123300031561SoilVNDVLASSDGTEALVAQGMAPEPGPPEALTERIRGDIEKWRSVAARAGIRPQ
Ga0318574_1037699413300031680SoilTAALVAQGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE
Ga0318496_1072280913300031713SoilVNDVLKSSDGTEALVAQGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE
Ga0306917_1110731123300031719SoilEVNDVLESSDGTEALVAQGMAPEPGPPEALTERIRGDIEKWRGVAARAGIRPQ
Ga0307468_10123530413300031740Hardwood Forest SoilLVAQGMEPEPGPPAALTERIRGDIEKWRGVVAKAGIRPE
Ga0318526_1041702113300031769SoilGMEPEPGPPEAVTQRICSDTEKWRAVVAKAGIRAE
Ga0318566_1001298313300031779SoilLVAQGMESEPGPPAAVSERIRSDIRKWREVAASAGIHAE
Ga0318497_1055798823300031805SoilMNDVLESSDGTAALVAQGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE
Ga0318527_1008671413300031859SoilSDGTEALVAQGMAPEPGPPEALTERIRGDIEKWRGVAARAGIRPQ
Ga0306919_1101960013300031879SoilVLKSSDGTEALVAQGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE
Ga0318536_1052466923300031893SoilSSADATEALIAQGMTAEPGPPDAVMQRIRADTAKWRDVAAKAGIRAE
Ga0306921_1153171613300031912SoilNREVNDVLESSDGTEALVAQGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE
Ga0310910_1066521413300031946SoilGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE
Ga0310906_1065439313300032013SoilKEAMIAQGMAPEPGPPEAVTERTRTDIEKWRGVVAKAGIRAE
Ga0318570_1006179813300032054SoilLSSADATEALIAQGMTAEPGPPDAVMQRIRADTAKWRDVAAKAGIRAE
Ga0318575_1000135013300032055SoilQGMGPEPGPPEALTEPIRGDIEKWRSVAVKAGIRPE
Ga0318533_1005706843300032059SoilLNREVNDVLESSDGIEALVAEGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE
Ga0318525_1037753023300032089SoilLGSADGKAALVAQGMESEPGPPAAVSERIRSDIRKWREVAASAGIHAE
Ga0318519_1077477523300033290SoilLESSDGTEALVAQGMAPEPGPPEALTERIRGDIEKWRGVAAKAGIRSE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.