NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F104644

Metagenome Family F104644

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F104644
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 65 residues
Representative Sequence VRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDESAAAP
Number of Associated Samples 97
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 89.00 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(11.000 % of family members)
Environment Ontology (ENVO) Unclassified
(25.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(37.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 44.07%    β-sheet: 0.00%    Coil/Unstructured: 55.93%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF13365Trypsin_2 50.00
PF13189Cytidylate_kin2 6.00
PF04972BON 3.00
PF03330DPBB_1 1.00
PF00211Guanylate_cyc 1.00
PF07516SecA_SW 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0653Preprotein translocase subunit SecA (ATPase, RNA helicase)Intracellular trafficking, secretion, and vesicular transport [U] 1.00
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.00 %
UnclassifiedrootN/A1.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000881|JGI10215J12807_1223199All Organisms → cellular organisms → Bacteria2556Open in IMG/M
3300000891|JGI10214J12806_11505383All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium698Open in IMG/M
3300001139|JGI10220J13317_10318596All Organisms → cellular organisms → Bacteria1411Open in IMG/M
3300003349|JGI26129J50193_1013757All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium594Open in IMG/M
3300003504|JGI26138J51218_101727All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium863Open in IMG/M
3300004114|Ga0062593_100423993All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300004156|Ga0062589_100557875All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300004643|Ga0062591_100038917All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2586Open in IMG/M
3300005336|Ga0070680_101602682All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium564Open in IMG/M
3300005345|Ga0070692_10123275All Organisms → cellular organisms → Bacteria1448Open in IMG/M
3300005438|Ga0070701_10351165All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300005440|Ga0070705_101380002All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium587Open in IMG/M
3300005458|Ga0070681_10579691All Organisms → cellular organisms → Bacteria → Proteobacteria1036Open in IMG/M
3300005468|Ga0070707_100115989All Organisms → cellular organisms → Bacteria2599Open in IMG/M
3300005518|Ga0070699_101892950All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium546Open in IMG/M
3300005545|Ga0070695_101251815All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium612Open in IMG/M
3300005549|Ga0070704_101119948All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium716Open in IMG/M
3300005577|Ga0068857_100010206All Organisms → cellular organisms → Bacteria → Proteobacteria8165Open in IMG/M
3300005615|Ga0070702_100120638All Organisms → cellular organisms → Bacteria1641Open in IMG/M
3300005713|Ga0066905_100047670All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2597Open in IMG/M
3300005887|Ga0075292_1068242All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium533Open in IMG/M
3300006845|Ga0075421_101743152All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium672Open in IMG/M
3300006847|Ga0075431_100912282All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium848Open in IMG/M
3300006847|Ga0075431_101432855All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium650Open in IMG/M
3300009162|Ga0075423_10038960All Organisms → cellular organisms → Bacteria → Proteobacteria4853Open in IMG/M
3300009174|Ga0105241_12090755All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium559Open in IMG/M
3300009545|Ga0105237_10820156All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300009553|Ga0105249_12794929All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium560Open in IMG/M
3300009792|Ga0126374_11229584All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium601Open in IMG/M
3300009795|Ga0105059_1003188All Organisms → cellular organisms → Bacteria1347Open in IMG/M
3300009806|Ga0105081_1007713All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300011419|Ga0137446_1051112All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium924Open in IMG/M
3300011429|Ga0137455_1211144All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium577Open in IMG/M
3300012226|Ga0137447_1002933All Organisms → cellular organisms → Bacteria → Proteobacteria1953Open in IMG/M
3300012912|Ga0157306_10023959All Organisms → cellular organisms → Bacteria1337Open in IMG/M
3300012951|Ga0164300_10122740All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300012955|Ga0164298_10160756All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300014321|Ga0075353_1176477All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium556Open in IMG/M
3300014884|Ga0180104_1017102All Organisms → cellular organisms → Bacteria1759Open in IMG/M
3300015077|Ga0173483_10517686All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium639Open in IMG/M
3300018054|Ga0184621_10263254All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium612Open in IMG/M
3300018465|Ga0190269_10984959All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium635Open in IMG/M
3300019887|Ga0193729_1159137All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium808Open in IMG/M
3300020579|Ga0210407_10587918All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium868Open in IMG/M
3300021406|Ga0210386_11604015All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium540Open in IMG/M
3300021560|Ga0126371_11201141All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300022534|Ga0224452_1178509All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium653Open in IMG/M
3300022694|Ga0222623_10104346All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300022756|Ga0222622_10342267All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300023067|Ga0247743_1005020All Organisms → cellular organisms → Bacteria1531Open in IMG/M
3300025321|Ga0207656_10441891All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium657Open in IMG/M
3300025326|Ga0209342_11202309All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium559Open in IMG/M
3300025885|Ga0207653_10098522All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300025898|Ga0207692_10425319All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium832Open in IMG/M
3300025901|Ga0207688_11089011All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300025904|Ga0207647_10100532All Organisms → cellular organisms → Bacteria1716Open in IMG/M
3300025906|Ga0207699_10584387All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium812Open in IMG/M
3300025907|Ga0207645_10130175All Organisms → cellular organisms → Bacteria1637Open in IMG/M
3300025911|Ga0207654_11100266All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium579Open in IMG/M
3300025912|Ga0207707_10920196All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium722Open in IMG/M
3300025930|Ga0207701_11250424All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium610Open in IMG/M
3300025936|Ga0207670_10287207All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300025945|Ga0207679_10025428All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4071Open in IMG/M
3300025971|Ga0210102_1085011All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium682Open in IMG/M
3300026001|Ga0208000_103287All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300026035|Ga0207703_10394185All Organisms → cellular organisms → Bacteria1283Open in IMG/M
3300026354|Ga0257180_1005260All Organisms → cellular organisms → Bacteria1400Open in IMG/M
3300026359|Ga0257163_1018397All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300026446|Ga0257178_1008845All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300026480|Ga0257177_1010587All Organisms → cellular organisms → Bacteria1218Open in IMG/M
3300026494|Ga0257159_1000622All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4178Open in IMG/M
3300026497|Ga0257164_1021806All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300026497|Ga0257164_1022399All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300026499|Ga0257181_1058771All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium647Open in IMG/M
3300026507|Ga0257165_1009782All Organisms → cellular organisms → Bacteria1483Open in IMG/M
3300026551|Ga0209648_10166547All Organisms → cellular organisms → Bacteria1722Open in IMG/M
3300026557|Ga0179587_10107888All Organisms → cellular organisms → Bacteria1693Open in IMG/M
3300027364|Ga0209967_1027660All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300027383|Ga0209213_1025242Not Available1117Open in IMG/M
3300027765|Ga0209073_10243101All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium697Open in IMG/M
3300027775|Ga0209177_10013249All Organisms → cellular organisms → Bacteria1898Open in IMG/M
3300027876|Ga0209974_10002335All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae6888Open in IMG/M
3300027894|Ga0209068_10022298All Organisms → cellular organisms → Bacteria3093Open in IMG/M
3300027915|Ga0209069_10462091All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium707Open in IMG/M
3300027947|Ga0209868_1005602All Organisms → cellular organisms → Bacteria1174Open in IMG/M
(restricted) 3300028043|Ga0233417_10230085All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium822Open in IMG/M
3300028784|Ga0307282_10352015All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium712Open in IMG/M
3300028828|Ga0307312_10457473All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium841Open in IMG/M
3300030336|Ga0247826_10968548All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium674Open in IMG/M
3300030336|Ga0247826_11545220All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium539Open in IMG/M
3300030606|Ga0299906_10293541All Organisms → cellular organisms → Bacteria1271Open in IMG/M
3300030620|Ga0302046_10574227All Organisms → cellular organisms → Bacteria920Open in IMG/M
(restricted) 3300031197|Ga0255310_10243516All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium509Open in IMG/M
3300031229|Ga0299913_10221969All Organisms → cellular organisms → Bacteria1871Open in IMG/M
3300031716|Ga0310813_11563547All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium615Open in IMG/M
3300032180|Ga0307471_100174068All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae2112Open in IMG/M
3300033004|Ga0335084_12069620All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium553Open in IMG/M
3300033513|Ga0316628_102831757All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium637Open in IMG/M
3300034817|Ga0373948_0085704All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium725Open in IMG/M
3300034820|Ga0373959_0019000All Organisms → cellular organisms → Bacteria1298Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.00%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil4.00%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere4.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.00%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand3.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.00%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.00%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil2.00%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.00%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.00%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.00%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.00%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001139Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
3300003349Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PMHost-AssociatedOpen in IMG/M
3300003504Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AMHost-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005887Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009795Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50EnvironmentalOpen in IMG/M
3300009806Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60EnvironmentalOpen in IMG/M
3300011419Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2EnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300012226Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300014321Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1EnvironmentalOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023067Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025971Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026001Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026354Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-BEnvironmentalOpen in IMG/M
3300026359Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-AEnvironmentalOpen in IMG/M
3300026446Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-BEnvironmentalOpen in IMG/M
3300026480Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-BEnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026499Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-BEnvironmentalOpen in IMG/M
3300026507Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-BEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027364Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027383Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027947Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300028043 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MGEnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI10215J12807_122319913300000881SoilVRYRHVWPGLLLLAALGLLLAGLVRWGDHFLSPGPTGGIHRLLQLWAASRPGDELAAAPVSAG
JGI10214J12806_1150538323300000891SoilVRYRHAWPGFLLLAALGLLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRPADESIAPPAAAAP
JGI10220J13317_1031859613300001139SoilVRYRHVWPGLLLLAALGLLLAGLVRWGDHFLSPGPTGGIHRLLQLWAASRPGDELAAAPVSAGTASVDPAAP
JGI26129J50193_101375723300003349Arabidopsis Thaliana RhizosphereVRYRHVWPGLLLLAALGLLLAGLVRWGDHFLSPGPTGGIHRLLQLWAASRPGDELAAAPVSAGTASVDPAAPPXV
JGI26138J51218_10172713300003504Arabidopsis Thaliana RhizosphereVRYRHVWPGLLLLAALGLLLAGLVRWGDHFLSPGPTGGIHRLLQLWAASRPGDELAAAPVSAGTASVDPAAPPPVSLPSMPSTAEA
Ga0062593_10042399323300004114SoilVRYRHVWPGLLLLAALGLLLAGLVRWGDHFLSPGPTGGIHRLLQLWAASRPGDELAAAPVSAGTASVDPAAPPPV
Ga0062589_10055787513300004156SoilVRYRHAWPGFLLLAALGLLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRPADESIAPPAAAAPSP
Ga0062591_10003891743300004643SoilVRYRHVWPGLLLLAALGLLLAGLVRWGDHFLSPGPTGGIHRLLQLWAASRPGDELAAAPVSAGTASVDPAAPP
Ga0070680_10160268213300005336Corn RhizosphereVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRPADE
Ga0070692_1012327513300005345Corn, Switchgrass And Miscanthus RhizosphereVRYRHVWPGVLLLAALALLLLGLLRWGDHFLSPGPTGGIHRLLQLWAASRPA
Ga0070701_1035116523300005438Corn, Switchgrass And Miscanthus RhizosphereVRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSRLPDESAPGPVVSAPSAGGEAPV
Ga0070705_10138000223300005440Corn, Switchgrass And Miscanthus RhizosphereVRYRHVWPGILLLVALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDEPAAAPT
Ga0070681_1057969123300005458Corn RhizosphereVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRPADESITPPAAAAPSPAMDAPATPPVAAGPSV
Ga0070707_10011598943300005468Corn, Switchgrass And Miscanthus RhizosphereVRYRHAWPGFLLLVALGLLLVGLVRWGDHFLTPGPTGGIHRLLQLWAASRPHDESAAAPQIAAAPS
Ga0070699_10189295023300005518Corn, Switchgrass And Miscanthus RhizosphereVRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSRL
Ga0070695_10125181523300005545Corn, Switchgrass And Miscanthus RhizosphereVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDESVAAPQIASAPLPVTDAPVSPPG
Ga0070704_10111994823300005549Corn, Switchgrass And Miscanthus RhizosphereVRYRHVWPGILLLVALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDEPAA
Ga0068857_100010206113300005577Corn RhizosphereVRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSRLPDESAPGPVVSAPSAGGEAPVSP
Ga0070702_10012063823300005615Corn, Switchgrass And Miscanthus RhizosphereVRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSRLPDESAPGPVVSAPSAGGEAPVSPSVSVPPVDPS
Ga0066905_10004767043300005713Tropical Forest SoilVRYRHVWPGLLLLAALGLLLAGLVRWGDHFLSPGPTGGIHRLLHLWAASRPADESAAVPV
Ga0075292_106824213300005887Rice Paddy SoilVRYRHVWPGLLLLAALALLLVGLLRWGGHFLSPGPSGGIHRLLQLWAASRPPDEPAAPPP
Ga0075421_10174315223300006845Populus RhizosphereVRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSRLPDESAPGPVVSAPSAGGEAP
Ga0075431_10091228223300006847Populus RhizosphereVRYRHAWPGFLLLTALALLLVGLLQWGDHFLSPGPTGGIHRLLQLWAASRPAEESIAPPAAAAPAAT
Ga0075431_10143285513300006847Populus RhizosphereVRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSRLPDESAP
Ga0075423_1003896073300009162Populus RhizosphereVRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSRLPDESAPGPV
Ga0105241_1209075523300009174Corn RhizosphereVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRPADESITPPAAAAP
Ga0105237_1082015613300009545Corn RhizosphereLLLASLALLLVALVRWGDHFLSPGPAGGIHRLLQLWAPSRLPDESAPGPVVSAPSAGGEAPVSP
Ga0105249_1279492923300009553Switchgrass RhizosphereVRYRHVWPGVLLLAALVLLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRPADESITPPAAAAPSPAMDAPATPPV
Ga0126374_1122958423300009792Tropical Forest SoilVRYRHVWPGVLLLAALGLLLVGLLRWSDHFLSPGPTGGIHRLLQLWAASRPPDESAAAPQVAAAPSA
Ga0105059_100318813300009795Groundwater SandVRYRHAWPGILLLAALGLLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRPHDESAAAPQMAAAPSPATDAPANPAPVV
Ga0105081_100771323300009806Groundwater SandVRYRHAWPGILLLAALGLLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRPHDESAAAPQMAAAPSPATDAPANPAPVVVPANP
Ga0137446_105111213300011419SoilVRYRHAWPGVLLLAALALLLVGLVRWGDHFLSPGPTGGIHRLLQLWAASRPADESIAPPAAAAPSTATDAPANPPV
Ga0137455_121114423300011429SoilVRYRHAWPGVLLLAALALLLVGLVRWGDHFLSPGPTGGIHRLLQLWAASRPADESIAPP
Ga0137447_100293313300012226SoilVRYRHAWPGVLLLAALALLLVGLVRWGDHFLSPGPTGGIHRLLQLWAASRPADESIAPPAAAAPSPAP
Ga0157306_1002395913300012912SoilVRYRHVWPGLLLLAALGLLLAGLVRWGDHFLSPGPTGGIHRLLQLWAASRPGDELAAA
Ga0164300_1012274013300012951SoilLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSRLPDESAPGP
Ga0164298_1016075623300012955SoilVRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSRLPDESAPGPVVSAPSAGGEAPVS
Ga0075353_117647723300014321Natural And Restored WetlandsVRYRHVWPGFLLLAALALLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRPAEEAITPT
Ga0180104_101710233300014884SoilVRYRHAWPGFLLLAALALLLVGLVRWGDHFLSPGPTGGIHRLLQLWAASRPADES
Ga0173483_1051768623300015077SoilVRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIRRLLQLWAPSRLPDESAPGPVVS
Ga0184621_1026325423300018054Groundwater SedimentVRYRHVWPGFLLLAALALLLVGLVRWGDHFLSPGPTGGIHRLLQLWAASRPADESIAPPAAAAPSLAMDAPVN
Ga0190269_1098495923300018465SoilVRYRHVWPGLLLLAALALLLVGLVRWGDHFLSPGPTGGIHRLLQLWAASRPHDQSAAAPQVAAAPSPATD
Ga0193729_115913713300019887SoilVRYRHVWPGLLLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDESAAAPQIASA
Ga0210407_1058791823300020579SoilVRYRHAWPGFLLLAALALLLVGLLQWGDHFLSPGPTGGIHRLLQLWAASRPPDEPAVAPPVAAAPARDPA
Ga0210386_1160401513300021406SoilVRYRHAWPGFLLLAALALLLVGLLQWGDHFLSPGPTGGIHRLLQLWAASRPPDEPAVAPP
Ga0126371_1120114123300021560Tropical Forest SoilVRYRHVWPGFLLLAALGLLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRP
Ga0224452_117850923300022534Groundwater SedimentVRYRHAWPGFLLLAALALLLVGLVRWGDHFLSPGPTGGIHRLLQLWAASRPADESIAPPAAAAPS
Ga0222623_1010434613300022694Groundwater SedimentVRYRHAWPGVLLLAALALLLVGLVRWGDHFLSPGPTGGIHRLLQLWAASRPADESIAPPAAAAPPAAADA
Ga0222622_1034226723300022756Groundwater SedimentVRYRHVWPGFLLLAALALLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRPADESITPPAAAAPSPAMDA
Ga0247743_100502023300023067SoilVRYRHVWPGLLLLAALGLLLAGLVRWGDHFLSPGPTGGIHRLLQLWAASRPGDELAAAPVSAGTASVDP
Ga0207656_1044189113300025321Corn RhizosphereVRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSR
Ga0209342_1120230913300025326SoilVRYRHAWPGLLLLAALALLLGALLTWGDHFLSPGPTGGIGGLLHLWPSSRPSP
Ga0207653_1009852223300025885Corn, Switchgrass And Miscanthus RhizosphereVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDESAAAPQIA
Ga0207692_1042531923300025898Corn, Switchgrass And Miscanthus RhizosphereVRYRHVWPGILLLVALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDES
Ga0207688_1108901123300025901Corn, Switchgrass And Miscanthus RhizosphereVRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSRLPDESAPGPVVSAPS
Ga0207647_1010053233300025904Corn RhizosphereVRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSRLP
Ga0207699_1058438713300025906Corn, Switchgrass And Miscanthus RhizosphereVRYRHVWPGILLLVALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDEPAAAPTTATDAPVSPPG
Ga0207645_1013017513300025907Miscanthus RhizosphereVRYRHVWPGVLLLAALVLLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRPADESITPPAAAAPSPAM
Ga0207654_1110026623300025911Corn RhizosphereVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRPADESITPPAAAAPSPGTDAPTNP
Ga0207707_1092019613300025912Corn RhizosphereVRYRHAWPGFLLLAALGLLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRPADESIAPPAAAAPSPVTDVPANPP
Ga0207701_1125042413300025930Corn, Switchgrass And Miscanthus RhizosphereVRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSRLPDESAAF
Ga0207670_1028720713300025936Switchgrass RhizosphereVRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSRLPDESAPGPVVSAPSAGGEAPVSPSVSVPPVDPSAP
Ga0207679_1002542863300025945Corn RhizosphereVRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSRLPDE
Ga0210102_108501113300025971Natural And Restored WetlandsVRYRHVWPGFLLLAALALLLVGLLWWGDHFLSPGPTGGINRLLQLWAASRPA
Ga0208000_10328713300026001Rice Paddy SoilVRYRHAWPGILLLAALALLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRPP
Ga0207703_1039418523300026035Switchgrass RhizosphereVRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSRLPDESAPGPVVSAPSAGGEAPVSPSVSVPPV
Ga0257180_100526023300026354SoilVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDESAAAPQIASAPSPVT
Ga0257163_101839723300026359SoilVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDESAAA
Ga0257178_100884513300026446SoilVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDESAAAPQIASAPSSVTDAPVSPP
Ga0257177_101058723300026480SoilVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDESAA
Ga0257159_100062213300026494SoilVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPP
Ga0257164_102180623300026497SoilVRYRHAWPGVLLLAALALLLVGLVRWGDHFLSPGPTGGIHRLLQLWAASRPADESIAPPAAAAPSP
Ga0257164_102239923300026497SoilVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDESVAAP
Ga0257181_105877123300026499SoilVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRP
Ga0257165_100978213300026507SoilVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDESAAAPQIASAPSPVTDAPVSPP
Ga0209648_1016654713300026551Grasslands SoilVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDESVAAPPVTSTPSPTT
Ga0179587_1010788813300026557Vadose Zone SoilVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDESAAAP
Ga0209967_102766023300027364Arabidopsis Thaliana RhizosphereVRYRHVWPGLLLLAALGLLLAGLVRWGDHFLSPGPTGGIHRLLQLWAASRP
Ga0209213_102524223300027383Forest SoilVRYRHVWPGFLLLAALALLLVGLVRWGDHFLSPGPTGGIHRLLQLWAASRPAD
Ga0209073_1024310113300027765Agricultural SoilLRYRHVWPGLLLLASLALLLLALVRWGDHFLSPGPGGGIQRLLQLWAPSRPPDESASAQPGPAVSVPASTG
Ga0209177_1001324913300027775Agricultural SoilVRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSRLPDESAPGPVVSAPSAGGEAPVSPSVSV
Ga0209974_1000233593300027876Arabidopsis Thaliana RhizosphereVRYRHVWPGLLLLAALGLLLAGLVRWGDHFLSPGPTGGIHRLLQLWAASRPG
Ga0209068_1002229853300027894WatershedsVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDESVAAPQVASA
Ga0209069_1046209123300027915WatershedsVRYRHAWPGLLLLAALALLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRPPDESAAAPQVAAAPAPTTDAP
Ga0209868_100560223300027947Groundwater SandVRYRHAWPGILLLAALGLLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRPHDESAAAPQMAAAPSPATDAPANPAPVVVPA
(restricted) Ga0233417_1023008523300028043SedimentVRYRHAWPGILLLAALALLLAALLRWGDHFLSPGPSGGIHRLLQLWAASRPSEESITAPPAIAAPAAPPEA
Ga0307282_1035201523300028784SoilVRYRHVWPGLLLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDESAA
Ga0307312_1045747313300028828SoilVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDESAAPPQIASAPSPVTDV
Ga0247826_1096854823300030336SoilVRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSRLPDESAPGPRRQE
Ga0247826_1154522023300030336SoilVRYRHVWPGVLLLAALALLLLGLLRWGDHFLSPGPTGGIHRLLQLWAASRPADESITPPAAAAPSPGTDAPTNPLVTG
Ga0299906_1029354113300030606SoilVRYRHVWPGFLLLAALALLLVGLVRWGDHFLSPGPTGGIHRLLQLWAASRPAEESITPPAAAAPSPA
Ga0302046_1057422713300030620SoilVRYRHAWPGVLLLIALALLLVGLVRWGDHFLSPGPTGGIHRLLQLWAASRS
(restricted) Ga0255310_1024351613300031197Sandy SoilVRYRHAWPGLLLLAALALLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRPPDESAAAPQVA
Ga0299913_1022196933300031229SoilVRYRHAWPGFLLLAALVLLLVGLLRWGDHFLSPGPTGGIHGLLQLWAASRPAEESVAPPAAAA
Ga0310813_1156354713300031716SoilVRYRHVWPGILLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPPDE
Ga0307471_10017406813300032180Hardwood Forest SoilVRYRHVWPGVLLLAALALLLVGLLRWGDHFLSPGPTGGIHRLLQLWAASRPSEEAIAPPASAAA
Ga0335084_1206962013300033004SoilVRYRHVWPGFLLLVALGLLLLGLLRWGDHFLSPGPTGGIHRLLQLWAASRPADESAVAPPVA
Ga0316628_10283175713300033513SoilVRYRHVWPGFLLLAALALLLVGLLRWGDHFLSPGPTGGINRLLQLWAASRPAEESIAPPAAAAPSPAMDA
Ga0373948_0085704_2_1573300034817Rhizosphere SoilMRYRHVWPGFLLLAALALLLVGLLRWGDHFLSPGPSGGIHRLLQLWAASRPP
Ga0373959_0019000_1064_12973300034820Rhizosphere SoilMRYRHVWPGLLLLASLALLLVALVRWGDHFLSPGPGGGIHRLLQLWAPSRLPDESAPGPVVSAPSAGGEAPVSPPVSV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.