


| Basic Information | |
|---|---|
| Family ID | F104610 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNGNT |
| Number of Associated Samples | 77 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 3.00 % |
| % of genes near scaffold ends (potentially truncated) | 65.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.00 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (20.000 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (29.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (63.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (81.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01381 | HTH_3 | 22.00 |
| PF11753 | DUF3310 | 2.00 |
| PF08291 | Peptidase_M15_3 | 1.00 |
| PF06147 | DUF968 | 1.00 |
| PF12705 | PDDEXK_1 | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.00 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 19.00 % |
| Unclassified | root | N/A | 16.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10064953 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1349 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10097669 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1115 | Open in IMG/M |
| 3300006870|Ga0075479_10394959 | All Organisms → Viruses | 534 | Open in IMG/M |
| 3300006920|Ga0070748_1166317 | All Organisms → Viruses | 816 | Open in IMG/M |
| 3300006929|Ga0098036_1042115 | All Organisms → Viruses → Predicted Viral | 1425 | Open in IMG/M |
| 3300007234|Ga0075460_10202068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 676 | Open in IMG/M |
| 3300007236|Ga0075463_10235034 | Not Available | 589 | Open in IMG/M |
| 3300007276|Ga0070747_1257436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 605 | Open in IMG/M |
| 3300007344|Ga0070745_1067320 | All Organisms → Viruses | 1442 | Open in IMG/M |
| 3300007344|Ga0070745_1321105 | unclassified Hyphomonas → Hyphomonas sp. | 548 | Open in IMG/M |
| 3300007538|Ga0099851_1091891 | All Organisms → Viruses → Predicted Viral | 1162 | Open in IMG/M |
| 3300007539|Ga0099849_1168240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 839 | Open in IMG/M |
| 3300007541|Ga0099848_1020760 | All Organisms → Viruses → Predicted Viral | 2803 | Open in IMG/M |
| 3300007542|Ga0099846_1279870 | All Organisms → Viruses | 574 | Open in IMG/M |
| 3300007725|Ga0102951_1102794 | Not Available | 811 | Open in IMG/M |
| 3300007725|Ga0102951_1153748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 649 | Open in IMG/M |
| 3300007960|Ga0099850_1237798 | All Organisms → Viruses | 705 | Open in IMG/M |
| 3300009000|Ga0102960_1147264 | All Organisms → Viruses | 849 | Open in IMG/M |
| 3300009001|Ga0102963_1193852 | All Organisms → Viruses → environmental samples → uncultured marine virus | 811 | Open in IMG/M |
| 3300009001|Ga0102963_1197289 | unclassified Hyphomonas → Hyphomonas sp. | 803 | Open in IMG/M |
| 3300009027|Ga0102957_1070597 | All Organisms → Viruses | 1202 | Open in IMG/M |
| 3300009071|Ga0115566_10045506 | All Organisms → Viruses | 3013 | Open in IMG/M |
| 3300009076|Ga0115550_1117285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 964 | Open in IMG/M |
| 3300009193|Ga0115551_1126105 | All Organisms → Viruses | 1186 | Open in IMG/M |
| 3300009193|Ga0115551_1279391 | Not Available | 733 | Open in IMG/M |
| 3300009423|Ga0115548_1252902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 541 | Open in IMG/M |
| 3300009433|Ga0115545_1253033 | All Organisms → Viruses | 591 | Open in IMG/M |
| 3300009434|Ga0115562_1046984 | All Organisms → Viruses → Predicted Viral | 1947 | Open in IMG/M |
| 3300009435|Ga0115546_1221151 | Not Available | 652 | Open in IMG/M |
| 3300009437|Ga0115556_1153107 | unclassified Hyphomonas → Hyphomonas sp. | 849 | Open in IMG/M |
| 3300009437|Ga0115556_1283792 | All Organisms → Viruses | 585 | Open in IMG/M |
| 3300009449|Ga0115558_1139892 | All Organisms → Viruses → Predicted Viral | 1030 | Open in IMG/M |
| 3300009505|Ga0115564_10236482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 937 | Open in IMG/M |
| 3300010148|Ga0098043_1057622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1178 | Open in IMG/M |
| 3300010148|Ga0098043_1178392 | Not Available | 593 | Open in IMG/M |
| 3300010149|Ga0098049_1282101 | Not Available | 502 | Open in IMG/M |
| 3300010150|Ga0098056_1106564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 955 | Open in IMG/M |
| 3300010300|Ga0129351_1248987 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 680 | Open in IMG/M |
| 3300010300|Ga0129351_1347307 | Not Available | 557 | Open in IMG/M |
| 3300010368|Ga0129324_10193843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 828 | Open in IMG/M |
| 3300010368|Ga0129324_10230070 | All Organisms → Viruses | 744 | Open in IMG/M |
| 3300010368|Ga0129324_10296840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 636 | Open in IMG/M |
| 3300011252|Ga0151674_1005632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 842 | Open in IMG/M |
| 3300011252|Ga0151674_1023398 | unclassified Hyphomonas → Hyphomonas sp. | 1480 | Open in IMG/M |
| 3300011254|Ga0151675_1025838 | All Organisms → Viruses | 1977 | Open in IMG/M |
| 3300017709|Ga0181387_1093710 | All Organisms → Viruses | 613 | Open in IMG/M |
| 3300017726|Ga0181381_1131102 | unclassified Hyphomonas → Hyphomonas sp. | 523 | Open in IMG/M |
| 3300017738|Ga0181428_1144464 | Not Available | 556 | Open in IMG/M |
| 3300017739|Ga0181433_1039589 | All Organisms → Viruses | 1214 | Open in IMG/M |
| 3300017739|Ga0181433_1104414 | unclassified Hyphomonas → Hyphomonas sp. | 686 | Open in IMG/M |
| 3300017745|Ga0181427_1087658 | All Organisms → Viruses | 762 | Open in IMG/M |
| 3300017748|Ga0181393_1130619 | unclassified Hyphomonas → Hyphomonas sp. | 633 | Open in IMG/M |
| 3300017783|Ga0181379_1071388 | All Organisms → Viruses → Predicted Viral | 1298 | Open in IMG/M |
| 3300017786|Ga0181424_10203396 | All Organisms → Viruses | 838 | Open in IMG/M |
| 3300018036|Ga0181600_10078968 | All Organisms → Viruses → Predicted Viral | 2001 | Open in IMG/M |
| 3300018048|Ga0181606_10088966 | unclassified Hyphomonas → Hyphomonas sp. | 1969 | Open in IMG/M |
| 3300018416|Ga0181553_10293635 | unclassified Hyphomonas → Hyphomonas sp. | 907 | Open in IMG/M |
| 3300018416|Ga0181553_10532665 | All Organisms → Viruses | 625 | Open in IMG/M |
| 3300018416|Ga0181553_10735084 | Not Available | 514 | Open in IMG/M |
| 3300018417|Ga0181558_10234816 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
| 3300018420|Ga0181563_10799142 | Not Available | 516 | Open in IMG/M |
| 3300018421|Ga0181592_10615104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 735 | Open in IMG/M |
| 3300018424|Ga0181591_10231298 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1439 | Open in IMG/M |
| 3300019459|Ga0181562_10065031 | All Organisms → Viruses → Predicted Viral | 2172 | Open in IMG/M |
| 3300019459|Ga0181562_10091327 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1749 | Open in IMG/M |
| 3300019756|Ga0194023_1093284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 607 | Open in IMG/M |
| 3300019756|Ga0194023_1098465 | unclassified Hyphomonas → Hyphomonas sp. | 590 | Open in IMG/M |
| 3300019765|Ga0194024_1030285 | unclassified Hyphomonas → Hyphomonas sp. | 1175 | Open in IMG/M |
| 3300020051|Ga0181555_1047639 | unclassified Hyphomonas → Hyphomonas sp. | 2196 | Open in IMG/M |
| 3300020053|Ga0181595_10292777 | unclassified Hyphomonas → Hyphomonas sp. | 670 | Open in IMG/M |
| 3300020174|Ga0181603_10098736 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1357 | Open in IMG/M |
| 3300021364|Ga0213859_10205298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 912 | Open in IMG/M |
| 3300021960|Ga0222715_10419434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 728 | Open in IMG/M |
| 3300021964|Ga0222719_10439434 | Not Available | 800 | Open in IMG/M |
| 3300022187|Ga0196899_1082394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 982 | Open in IMG/M |
| 3300022907|Ga0255775_1047351 | unclassified Hyphomonas → Hyphomonas sp. | 2167 | Open in IMG/M |
| 3300022925|Ga0255773_10023755 | Not Available | 4093 | Open in IMG/M |
| 3300022926|Ga0255753_1108637 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1340 | Open in IMG/M |
| 3300022927|Ga0255769_10033117 | All Organisms → Viruses | 3367 | Open in IMG/M |
| 3300025086|Ga0208157_1037193 | unclassified Hyphomonas → Hyphomonas sp. | 1370 | Open in IMG/M |
| 3300025652|Ga0208134_1133231 | All Organisms → Viruses | 646 | Open in IMG/M |
| 3300025759|Ga0208899_1050044 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1794 | Open in IMG/M |
| 3300025759|Ga0208899_1186000 | unclassified Hyphomonas → Hyphomonas sp. | 673 | Open in IMG/M |
| 3300025759|Ga0208899_1193390 | unclassified Hyphomonas → Hyphomonas sp. | 653 | Open in IMG/M |
| 3300025769|Ga0208767_1058846 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1740 | Open in IMG/M |
| 3300025769|Ga0208767_1136380 | unclassified Hyphomonas → Hyphomonas sp. | 916 | Open in IMG/M |
| 3300025810|Ga0208543_1153403 | Not Available | 538 | Open in IMG/M |
| 3300025853|Ga0208645_1251793 | Not Available | 587 | Open in IMG/M |
| 3300025889|Ga0208644_1269887 | All Organisms → Viruses | 693 | Open in IMG/M |
| 3300026183|Ga0209932_1051933 | Not Available | 984 | Open in IMG/M |
| 3300026183|Ga0209932_1094627 | All Organisms → Viruses | 666 | Open in IMG/M |
| 3300026187|Ga0209929_1068300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 972 | Open in IMG/M |
| 3300028115|Ga0233450_10110870 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1441 | Open in IMG/M |
| 3300034374|Ga0348335_002471 | Not Available | 12753 | Open in IMG/M |
| 3300034374|Ga0348335_030707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2370 | Open in IMG/M |
| 3300034375|Ga0348336_018328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3740 | Open in IMG/M |
| 3300034375|Ga0348336_048405 | All Organisms → Viruses → Predicted Viral | 1777 | Open in IMG/M |
| 3300034418|Ga0348337_051386 | All Organisms → Viruses | 1653 | Open in IMG/M |
| 3300034418|Ga0348337_081942 | All Organisms → Viruses → Predicted Viral | 1123 | Open in IMG/M |
| 3300034418|Ga0348337_168761 | unclassified Hyphomonas → Hyphomonas sp. | 590 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 29.00% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 19.00% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 12.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.00% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 7.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 6.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.00% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.00% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 3.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.00% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.00% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 2.00% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022926 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100649531 | 3300000115 | Marine | KAKKETTEYYLPEYNRICVSNAENKQQYKGENNDNNQERR* |
| DelMOSpr2010_100976693 | 3300000116 | Marine | AKKETTEYYLPEYNRICVSNAENKQQYKGENNDNNQERR* |
| Ga0075479_103949591 | 3300006870 | Aqueous | AINKVISRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENK* |
| Ga0070748_11663173 | 3300006920 | Aqueous | KAKKETTEYYLPEYNRICVSNAENKQQYKGENNG* |
| Ga0098036_10421151 | 3300006929 | Marine | ISKSKAKKETTQHYLAEYNRVCVSNAENKQQYKGENNGNT* |
| Ga0075460_102020682 | 3300007234 | Aqueous | MNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNDQTIHRK* |
| Ga0075463_102350343 | 3300007236 | Aqueous | RILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNG* |
| Ga0070747_12574362 | 3300007276 | Aqueous | MNRVISKSKTKKETTENYLAEYNRVCVSNAENKQQYKGENNGNT* |
| Ga0070745_10673202 | 3300007344 | Aqueous | MNRILSKSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNGNT* |
| Ga0070745_13211051 | 3300007344 | Aqueous | KKETTEYYLPEYNRICVSNAENKREYKYKGENNDQTIHRK* |
| Ga0099851_10918911 | 3300007538 | Aqueous | RSKAKKETTEYYLPEYNRICVSNAENKKQYKGENNGNS* |
| Ga0099849_11682402 | 3300007539 | Aqueous | MNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNGNS* |
| Ga0099848_10207605 | 3300007541 | Aqueous | MNRILSRSKAKKETTEYYLPEYNRICVSNAENKKQYKGENNGNS* |
| Ga0099846_12798701 | 3300007542 | Aqueous | KTKKETTENYLAEYNRVCVSNAENKQQYKGENNGNT* |
| Ga0102951_11027941 | 3300007725 | Water | SKTKKETTEHYLAEYNRVCVSKAENKQQYKGENK* |
| Ga0102951_11537481 | 3300007725 | Water | MNRIISKSKTKKETTEHYLAEYNRVCVSNAENKQQYKGENN |
| Ga0099850_12377982 | 3300007960 | Aqueous | MNKIISKSIAKKETTEYYLPEYNRICVSNAENKQQYKGENNGNT* |
| Ga0102960_11472642 | 3300009000 | Pond Water | MNRIISRSKAKKEITEHYLPEYNRVCVSKAENKQQYKGENNGNT* |
| Ga0102963_11938522 | 3300009001 | Pond Water | MNRIISRSKAKKETTEHYLAEYNRVCVSNAENKQQYKGENK* |
| Ga0102963_11972892 | 3300009001 | Pond Water | SKAKKEITEHYLPEYNRVCVSNAENKQQYKGENNAKTILRK* |
| Ga0102957_10705972 | 3300009027 | Pond Water | MNRIISKSKTKKETTEHYLAEYNRVCVSNAENKQQYKGENNGNS* |
| Ga0115566_100455062 | 3300009071 | Pelagic Marine | MNRILSKSKAKKETTEYYLPEYNRVCVSNAENKQQYKGENNA* |
| Ga0115550_11172852 | 3300009076 | Pelagic Marine | MNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENKCQNNT* |
| Ga0115551_11261054 | 3300009193 | Pelagic Marine | MNRILSRSKAKKENTEYYLPEYNRICVSNAENKQQYKGENNDEKKS* |
| Ga0115551_12793912 | 3300009193 | Pelagic Marine | MNKIISKSKTKKETTEYYLPEYNRVCVSNAENKQQYKGENK* |
| Ga0115548_12529022 | 3300009423 | Pelagic Marine | MNKIISKSKTKKETTEHYLAEYNRVCVSNAENKQQYKGENK* |
| Ga0115545_12530332 | 3300009433 | Pelagic Marine | MNRIVSKSKTKKETTEHYLAEYNRVCVSTAKNKQQYKGENNDEKKS* |
| Ga0115562_10469843 | 3300009434 | Pelagic Marine | MNKIISKSKTKKETTEHYLAEYNRVCVSNAENKQQYKGENNGNT* |
| Ga0115546_12211512 | 3300009435 | Pelagic Marine | MNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENKGKQKIE* |
| Ga0115556_11531073 | 3300009437 | Pelagic Marine | KAMNKIISKSKTKKETTEHYLAEYNRVCVSNAENKQQYKGENK* |
| Ga0115556_12837922 | 3300009437 | Pelagic Marine | MNRILSRSKAKKETTEYYLPEYNRICVSNAENKEQYKGENNGNS* |
| Ga0115558_11398922 | 3300009449 | Pelagic Marine | MNRILSRSKAKKETTEYYLPEYNRVCVSNAENKQQYKGENNGNS* |
| Ga0115564_102364822 | 3300009505 | Pelagic Marine | MNKIISKSKTKKETTEYYLPEYNRICVSNAENKQQYKGENNGNT* |
| Ga0098043_10576224 | 3300010148 | Marine | MNRIINKSKAKKETTELYLAEYNRVCVSNAENKQQYKGENNGNT* |
| Ga0098043_11783922 | 3300010148 | Marine | MNRIISKSKAKKETTELYLPEYNRVCVSNAENKQQYKGENK* |
| Ga0098049_12821011 | 3300010149 | Marine | NRIISKSKAKKETTELYLPEYNRVCVSNAENKQQYKGENK* |
| Ga0098056_11065643 | 3300010150 | Marine | MNRIISRSKAKKETTEHYLAEYNRVCVSNAENKQQYKGENNGNT* |
| Ga0129351_12489872 | 3300010300 | Freshwater To Marine Saline Gradient | MNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNDNNQERR* |
| Ga0129351_13473072 | 3300010300 | Freshwater To Marine Saline Gradient | MNRILSRSKAKKEITEYYLPEYNRVCVSNAENKQQYKGENK* |
| Ga0129324_101938431 | 3300010368 | Freshwater To Marine Saline Gradient | MNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENN |
| Ga0129324_102300701 | 3300010368 | Freshwater To Marine Saline Gradient | RSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNGNT* |
| Ga0129324_102968403 | 3300010368 | Freshwater To Marine Saline Gradient | VISKSKAKKETTEYYLPEYNRICVSNAENKQQYKGENK* |
| Ga0151674_10056322 | 3300011252 | Marine | MNRIISKSKAKKETTEHYLAEYNRVCVSKAENKQQYKGENK* |
| Ga0151674_10233984 | 3300011252 | Marine | RIIKKNKFKTEHIIEKYNRVCVSKAKNKQQYKGKNK* |
| Ga0151675_10258383 | 3300011254 | Marine | MNRIISRSKAKKETTEHYLAEYNRVCVSNAENKQQYKGENKCQNNT* |
| Ga0181387_10937102 | 3300017709 | Seawater | MEKGEQKKCKIISKSKAKKEATEHYLPEYNRVCVSKAENKQQYKGENNGNT |
| Ga0181381_11311022 | 3300017726 | Seawater | KSKAKKETTELYLPEYNRVCVSNAENKQQYKGENNDQTIYRK |
| Ga0181428_11444641 | 3300017738 | Seawater | IKAMNRIISKSKAKKETTELYLPEYNRVCVSNAENKQQYKGENNGV |
| Ga0181433_10395891 | 3300017739 | Seawater | RIISRSKAKKETTDHYLPEYNRVCVSNAENKQQYKGENK |
| Ga0181433_11044142 | 3300017739 | Seawater | MNRIISKSKAKKETTELYLPEYNRVCVSNAENKQQYKGENKCQNNT |
| Ga0181427_10876583 | 3300017745 | Seawater | MNRIISRSKAKKETTDHYLPEYNRVCVSNAENKQQYKGENK |
| Ga0181393_11306191 | 3300017748 | Seawater | SKAKKETTELYLPEYNRVCVSNAENKQQYKGENNDETIYRK |
| Ga0181379_10713881 | 3300017783 | Seawater | MAIHKTEHFIEEYNRVCVSKAKNKQQYKGENNGNT |
| Ga0181424_102033961 | 3300017786 | Seawater | MNKIISKSKAKKETTEHYLAEYNRVCVSTAKNKQQYKGENNA |
| Ga0181600_100789681 | 3300018036 | Salt Marsh | NRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNDNNQERR |
| Ga0181606_100889661 | 3300018048 | Salt Marsh | MNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENK |
| Ga0181553_102936351 | 3300018416 | Salt Marsh | MNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENKCQNNT |
| Ga0181553_105326653 | 3300018416 | Salt Marsh | NRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENK |
| Ga0181553_107350843 | 3300018416 | Salt Marsh | NRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENKXKQKI |
| Ga0181558_102348163 | 3300018417 | Salt Marsh | SKAKKETTEYYLPEYNRVCVSNAENKQQYKGENKXKQKI |
| Ga0181563_107991423 | 3300018420 | Salt Marsh | MNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENKXKQKI |
| Ga0181592_106151042 | 3300018421 | Salt Marsh | NRILSRSKAKKETTEYYLPEYNRVCVSNAENKQQYKGENNDNNQERR |
| Ga0181591_102312984 | 3300018424 | Salt Marsh | RSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNDNNQERR |
| Ga0181562_100650311 | 3300019459 | Salt Marsh | MNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNGNS |
| Ga0181562_100913275 | 3300019459 | Salt Marsh | SRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNDNNQERR |
| Ga0194023_10932841 | 3300019756 | Freshwater | SKAKKETTEYYLPEYNRICVSNAENKQQYKGENKXKQKIE |
| Ga0194023_10984652 | 3300019756 | Freshwater | MNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNDQTIHRK |
| Ga0194024_10302851 | 3300019765 | Freshwater | NRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNDQTIHRK |
| Ga0181555_10476395 | 3300020051 | Salt Marsh | LSRSKAKKETTEYYLPEYNRICASNAENKQQYKGENKCQNNT |
| Ga0181595_102927772 | 3300020053 | Salt Marsh | NRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNAKTILRK |
| Ga0181603_100987363 | 3300020174 | Salt Marsh | KSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNDNNQERR |
| Ga0213859_102052981 | 3300021364 | Seawater | KKETTEYYLPEYNRICVSNAENKQQYKGENNDNNQERR |
| Ga0222715_104194342 | 3300021960 | Estuarine Water | PKKETTEYYLPEYNRICVSNAENKQQYKGENNDNNQERR |
| Ga0222719_104394341 | 3300021964 | Estuarine Water | MNRILSGSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNGV |
| Ga0196899_10823943 | 3300022187 | Aqueous | ILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNDNNQERR |
| Ga0255775_10473515 | 3300022907 | Salt Marsh | KAKKETTEYYLPEYNRICVSNAENKQQYKGENKCQNNT |
| Ga0255773_1002375512 | 3300022925 | Salt Marsh | AMNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNGNS |
| Ga0255753_11086373 | 3300022926 | Salt Marsh | KAKKETTEYYLPEYNRICVSNAENKQQYKGENNDNNQERR |
| Ga0255769_100331171 | 3300022927 | Salt Marsh | MNRILSRSKAKKETTEYYLPEYNRVCVSNAENKQQYKGENNGNS |
| Ga0208157_10371931 | 3300025086 | Marine | RIKAMNRIISKSKAKKETTELYLPEYNRVCVSNAENKQQYKGENK |
| Ga0208134_11332312 | 3300025652 | Aqueous | NRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNGNT |
| Ga0208899_10500445 | 3300025759 | Aqueous | AMNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENKXKQKIE |
| Ga0208899_11860003 | 3300025759 | Aqueous | MNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNG |
| Ga0208899_11933901 | 3300025759 | Aqueous | SRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNDQTIHRK |
| Ga0208767_10588465 | 3300025769 | Aqueous | AMNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENK |
| Ga0208767_11363801 | 3300025769 | Aqueous | AMNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNG |
| Ga0208543_11534033 | 3300025810 | Aqueous | ILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNG |
| Ga0208645_12517933 | 3300025853 | Aqueous | SKSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNG |
| Ga0208644_12698872 | 3300025889 | Aqueous | RILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNGNT |
| Ga0209932_10519336 | 3300026183 | Pond Water | KSKTKKETTEYYLAEYNRVCVSNAENKQQYKGENNG |
| Ga0209932_10946272 | 3300026183 | Pond Water | TKKETTEYYLAEYNRVCVSNAENKQQYKGENNGNS |
| Ga0209929_10683001 | 3300026187 | Pond Water | KVISKSKAKKETTEHYLPEYNRICVSNAENKQQYKGENDVSNN |
| Ga0233450_101108701 | 3300028115 | Salt Marsh | KETTEYYLPEYNRICVSNAENKQQYKGENNDNNQERR |
| Ga0348335_002471_4475_4609 | 3300034374 | Aqueous | MNRIISRSQTKKETTEHYLPEYNRVCVSNAENKQQYKGENNGNT |
| Ga0348335_030707_1922_2038 | 3300034374 | Aqueous | VISRSKAKKETTEYYLPEYNRVCVSNAENKQQYKGENK |
| Ga0348336_018328_3593_3727 | 3300034375 | Aqueous | MNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNGNT |
| Ga0348336_048405_2_115 | 3300034375 | Aqueous | KKETTEYYLPEYNRICVSNAENKQQYKGENKWKQKIE |
| Ga0348337_051386_869_985 | 3300034418 | Aqueous | VISRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENK |
| Ga0348337_081942_20_166 | 3300034418 | Aqueous | MNRILSRSKAKKETTEYYLPEYNRICVSNAENKQQYKGENNDNNQERR |
| Ga0348337_168761_5_157 | 3300034418 | Aqueous | MNRILSKSKAKKETTEYYLPEYNRICVSNAENKREYKYKGENNDQTIHRK |
| ⦗Top⦘ |