Basic Information | |
---|---|
Family ID | F104095 |
Family Type | Metagenome |
Number of Sequences | 101 |
Average Sequence Length | 38 residues |
Representative Sequence | MGGAMTVVMVVMMVVMMGGMLVGGAWAFLRRGKRRRDD |
Number of Associated Samples | 66 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 86.02 % |
% of genes near scaffold ends (potentially truncated) | 8.91 % |
% of genes from short scaffolds (< 2000 bps) | 77.23 % |
Associated GOLD sequencing projects | 64 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.168 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (24.752 % of family members) |
Environment Ontology (ENVO) | Unclassified (54.455 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.337 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF08241 | Methyltransf_11 | 25.74 |
PF00753 | Lactamase_B | 5.94 |
PF12697 | Abhydrolase_6 | 4.95 |
PF00211 | Guanylate_cyc | 3.96 |
PF00561 | Abhydrolase_1 | 3.96 |
PF13977 | TetR_C_6 | 2.97 |
PF01545 | Cation_efflux | 2.97 |
PF01209 | Ubie_methyltran | 1.98 |
PF01872 | RibD_C | 1.98 |
PF09903 | DUF2130 | 0.99 |
PF00440 | TetR_N | 0.99 |
PF15919 | HicB_lk_antitox | 0.99 |
PF08818 | DUF1801 | 0.99 |
PF01980 | TrmO | 0.99 |
PF04389 | Peptidase_M28 | 0.99 |
PF02630 | SCO1-SenC | 0.99 |
PF00589 | Phage_integrase | 0.99 |
PF13400 | Tad | 0.99 |
PF02683 | DsbD | 0.99 |
PF00672 | HAMP | 0.99 |
PF04945 | YHS | 0.99 |
PF00330 | Aconitase | 0.99 |
PF09828 | Chrome_Resist | 0.99 |
PF08530 | PepX_C | 0.99 |
PF04545 | Sigma70_r4 | 0.99 |
PF16701 | Ad_Cy_reg | 0.99 |
COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
---|---|---|---|
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 3.96 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 2.97 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 2.97 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 2.97 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.98 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.98 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 1.98 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 1.98 |
COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
COG1720 | tRNA (Thr-GGU) A37 N6-methylase | Translation, ribosomal structure and biogenesis [J] | 0.99 |
COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.99 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.99 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.99 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.17 % |
Unclassified | root | N/A | 16.83 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_103050916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 967 | Open in IMG/M |
3300000956|JGI10216J12902_103618011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5824 | Open in IMG/M |
3300000956|JGI10216J12902_117201052 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300001361|A30PFW6_1393978 | Not Available | 539 | Open in IMG/M |
3300001686|C688J18823_10031294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3640 | Open in IMG/M |
3300005552|Ga0066701_10000007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 142819 | Open in IMG/M |
3300005552|Ga0066701_10001365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8341 | Open in IMG/M |
3300005552|Ga0066701_10154010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1386 | Open in IMG/M |
3300005552|Ga0066701_10577720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 687 | Open in IMG/M |
3300005559|Ga0066700_10691023 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300005560|Ga0066670_10235085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1108 | Open in IMG/M |
3300005561|Ga0066699_10279559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1185 | Open in IMG/M |
3300005563|Ga0068855_102139823 | Not Available | 563 | Open in IMG/M |
3300005568|Ga0066703_10867597 | Not Available | 515 | Open in IMG/M |
3300005576|Ga0066708_10442689 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300005586|Ga0066691_10259243 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
3300005587|Ga0066654_10296522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 865 | Open in IMG/M |
3300006032|Ga0066696_10190918 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
3300006046|Ga0066652_100378880 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
3300006791|Ga0066653_10424643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 679 | Open in IMG/M |
3300006796|Ga0066665_10292628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1306 | Open in IMG/M |
3300006797|Ga0066659_10718549 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300006797|Ga0066659_11569319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
3300006797|Ga0066659_11711476 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300006800|Ga0066660_10268150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1345 | Open in IMG/M |
3300009012|Ga0066710_100183425 | All Organisms → cellular organisms → Bacteria | 2959 | Open in IMG/M |
3300009093|Ga0105240_10016164 | All Organisms → cellular organisms → Bacteria | 10115 | Open in IMG/M |
3300009137|Ga0066709_100122865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3249 | Open in IMG/M |
3300009137|Ga0066709_100206104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2588 | Open in IMG/M |
3300009137|Ga0066709_100638840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1522 | Open in IMG/M |
3300009137|Ga0066709_101296476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1068 | Open in IMG/M |
3300009137|Ga0066709_101838341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 847 | Open in IMG/M |
3300009137|Ga0066709_102841243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 641 | Open in IMG/M |
3300009137|Ga0066709_103741819 | Not Available | 552 | Open in IMG/M |
3300009137|Ga0066709_103812290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. SYSU D00693 | 547 | Open in IMG/M |
3300009840|Ga0126313_10125368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1915 | Open in IMG/M |
3300009840|Ga0126313_10201598 | Not Available | 1527 | Open in IMG/M |
3300009840|Ga0126313_10339013 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
3300009840|Ga0126313_10854635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 741 | Open in IMG/M |
3300009873|Ga0131077_11762137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 502 | Open in IMG/M |
3300010038|Ga0126315_10534742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 751 | Open in IMG/M |
3300010038|Ga0126315_10996403 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300010041|Ga0126312_10008866 | All Organisms → cellular organisms → Bacteria | 6735 | Open in IMG/M |
3300010041|Ga0126312_10424481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 947 | Open in IMG/M |
3300010042|Ga0126314_10371360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1028 | Open in IMG/M |
3300010042|Ga0126314_10865892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 667 | Open in IMG/M |
3300010303|Ga0134082_10530416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
3300010333|Ga0134080_10193765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 878 | Open in IMG/M |
3300010333|Ga0134080_10284179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 738 | Open in IMG/M |
3300010333|Ga0134080_10587739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
3300011003|Ga0138514_100055606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 807 | Open in IMG/M |
3300012199|Ga0137383_10293389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1191 | Open in IMG/M |
3300012199|Ga0137383_10346964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1087 | Open in IMG/M |
3300012200|Ga0137382_10744171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 704 | Open in IMG/M |
3300012200|Ga0137382_11290329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 516 | Open in IMG/M |
3300012201|Ga0137365_10460524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 936 | Open in IMG/M |
3300012204|Ga0137374_10891202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 654 | Open in IMG/M |
3300012206|Ga0137380_10932085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 745 | Open in IMG/M |
3300012206|Ga0137380_11433725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 575 | Open in IMG/M |
3300012207|Ga0137381_11476549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 572 | Open in IMG/M |
3300012285|Ga0137370_10391826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 840 | Open in IMG/M |
3300012350|Ga0137372_10293024 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
3300012351|Ga0137386_10970781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 606 | Open in IMG/M |
3300012354|Ga0137366_10277758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1236 | Open in IMG/M |
3300012355|Ga0137369_10219827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1456 | Open in IMG/M |
3300012356|Ga0137371_10660967 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300012356|Ga0137371_10849841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 694 | Open in IMG/M |
3300012356|Ga0137371_11007695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 631 | Open in IMG/M |
3300012356|Ga0137371_11395470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 514 | Open in IMG/M |
3300012358|Ga0137368_10542769 | Not Available | 744 | Open in IMG/M |
3300012358|Ga0137368_10723907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 623 | Open in IMG/M |
3300012360|Ga0137375_10909445 | Not Available | 698 | Open in IMG/M |
3300012360|Ga0137375_11313404 | Not Available | 545 | Open in IMG/M |
3300012977|Ga0134087_10254969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 806 | Open in IMG/M |
3300013766|Ga0120181_1051120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 932 | Open in IMG/M |
3300014829|Ga0120104_1073680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
3300018061|Ga0184619_10338878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 687 | Open in IMG/M |
3300018063|Ga0184637_10000044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 75740 | Open in IMG/M |
3300018431|Ga0066655_11209521 | Not Available | 536 | Open in IMG/M |
3300018432|Ga0190275_13436694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 513 | Open in IMG/M |
3300018433|Ga0066667_10182562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1521 | Open in IMG/M |
3300018468|Ga0066662_10307495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1336 | Open in IMG/M |
3300018468|Ga0066662_10365024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1250 | Open in IMG/M |
3300018468|Ga0066662_10628697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1010 | Open in IMG/M |
3300021073|Ga0210378_10055144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1565 | Open in IMG/M |
3300025944|Ga0207661_10012993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6076 | Open in IMG/M |
3300026524|Ga0209690_1000004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 165224 | Open in IMG/M |
3300026552|Ga0209577_10059905 | All Organisms → cellular organisms → Bacteria | 3185 | Open in IMG/M |
3300028811|Ga0307292_10126343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1021 | Open in IMG/M |
3300028878|Ga0307278_10004150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7005 | Open in IMG/M |
3300028878|Ga0307278_10142946 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
3300031995|Ga0307409_102188018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 583 | Open in IMG/M |
3300034377|Ga0334931_000287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 17183 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 24.75% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 14.85% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 9.90% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.95% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.95% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.98% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 1.98% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.99% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.99% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.99% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.99% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.99% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.99% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001361 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illumina | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300034377 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 27HNS | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1030509161 | 3300000956 | Soil | MMDGAMTIVMVVMMVVMMGGMVAGAAWAFVRRRRGKHGDE* |
JGI10216J12902_1036180113 | 3300000956 | Soil | MTVVMVVMMVIVMGGMVAGGAWAMIRRRRGKRDERER* |
JGI10216J12902_1172010522 | 3300000956 | Soil | MGGAMTVVMVVMMVVMMGGMLVGGAWAFLRKRRRREDD* |
A30PFW6_13939782 | 3300001361 | Permafrost | MGGSTVMTIAMIVMMVVMMGGMLVGAGWAFLRRRRQRDR* |
C688J18823_100312945 | 3300001686 | Soil | MMGGSTLVTIVMVAMMVVMMGGMLAGGAWAFLRRRRR* |
C688J35102_1196508852 | 3300002568 | Soil | MGGSTILTVAMIAMMALMMGGMVAGTVWAVVRRRRRGPGDRE* |
Ga0066701_10000007158 | 3300005552 | Soil | MGGAMTVVMVVMMGGMLVGGAWALVRRGKRRRDD* |
Ga0066701_100013653 | 3300005552 | Soil | MGGAMTVVMVVMMVVMMGGMLLGGAWAFLRRGKRRRGN* |
Ga0066701_101540102 | 3300005552 | Soil | MMGGGAMTVVMIIVMAVMMGGMVVGGAWALVRRRRQRD* |
Ga0066701_105777202 | 3300005552 | Soil | MSGAMTVVMVVMMVVMMGGMLVGGAWAFLRRGKRRRDD* |
Ga0066700_106910232 | 3300005559 | Soil | MGGAMTVVMVVMMVVMMGGMLVGGAWAFLRRGKRRRDD* |
Ga0066670_102350851 | 3300005560 | Soil | MMGGGAMTVVMIVVMVVMMGGMIVGGGWALLRRRRERD* |
Ga0066699_102795591 | 3300005561 | Soil | RGDGVGGAITLVMVMMMGGTLLGGGAALVRRGKRRRHD* |
Ga0068855_1021398231 | 3300005563 | Corn Rhizosphere | VMGGSALVSVPMVLMMVVMMGGMLVGGAWAFLRRRRR |
Ga0066703_108675972 | 3300005568 | Soil | MMGGGAMTVVMIVVMAVMMGGMIVGGGWALMRRRR |
Ga0066708_104426892 | 3300005576 | Soil | MTGAMTVVMVVMMVVMMGGMLAGAAWAFLRRGKRRRDD* |
Ga0066691_102592432 | 3300005586 | Soil | MSGAMTVVMVVMMVVMIGGMLVAGVWAFVRRGKRRRDD* |
Ga0066654_102965222 | 3300005587 | Soil | MMGGGAMTIVMVVMMGGMVVGGGWALLRRRKQRD* |
Ga0066651_100094711 | 3300006031 | Soil | MMGGSTILIIAMGVMMVVMMGGMVVGGIWALIRRRRR* |
Ga0066696_101909183 | 3300006032 | Soil | MGGAMTVVMVVMMVLMMGGMLVGGAWAFVRRGKRRRDN* |
Ga0066652_1003788802 | 3300006046 | Soil | MSGAMAVVMVAMMVVMMGGMLVGGAWAFIRRRRHRSDR* |
Ga0066653_104246432 | 3300006791 | Soil | MGGAMTVVMVVMMGGMLVGGAWAFLRRGKRRRDD* |
Ga0066665_102926282 | 3300006796 | Soil | GAMTVVMIVVMAVMMGGMVVGGAWALVRRRRQRD* |
Ga0066659_107185491 | 3300006797 | Soil | MGGAMTVVMVVMMVLMMGGMLVGGAWAFVRRGRRRRGD* |
Ga0066659_115693192 | 3300006797 | Soil | MGGAMTVVMVVMMVVMMGGMLVAGAWAFVRRGKRRRDD* |
Ga0066659_117114761 | 3300006797 | Soil | MGGAMTVVIVVMMVVMMGGMLAGAARAFVRRGKRRRDD* |
Ga0066660_102681502 | 3300006800 | Soil | MGGAMTVVMVVMMVLMMGGMLVGGAWALVRRGKRRRDD* |
Ga0066710_1001834252 | 3300009012 | Grasslands Soil | MSGAMAVVMVAMMVVMMGGMLVGGAWAFIRRRRHRSDR |
Ga0105240_1001616410 | 3300009093 | Corn Rhizosphere | MGGSALVSVPMVLMMVVMMGGMLVGGAWAFLRRRRR* |
Ga0066709_1001228652 | 3300009137 | Grasslands Soil | MTVVMVVMMVVMMGGMLLGGAWAFVRRGKRRRDD* |
Ga0066709_1002061043 | 3300009137 | Grasslands Soil | MGSLMTIAMLEMMVAMMGGMMVAGAWAFVRRVKRHRDD* |
Ga0066709_1006388404 | 3300009137 | Grasslands Soil | MGGAMTVVMVVMMGGMLVGGAWAFVRRGKRRRDD* |
Ga0066709_1012964761 | 3300009137 | Grasslands Soil | MGGVTTVLMVVMMVVMMGGMLAGAAWGLMRRGKRRRPG* |
Ga0066709_1018383411 | 3300009137 | Grasslands Soil | MMGGGAMTIVMVVVMIVMMGGMIAGAGWALLRRSRRRSPRS* |
Ga0066709_1028412431 | 3300009137 | Grasslands Soil | GGGAMTVVMIIVMAVMMGGMVVGGAWALVRRRRQRD* |
Ga0066709_1037418191 | 3300009137 | Grasslands Soil | MMGGGAMTVVMIIVMVVMMGGMIAGGAWAMLRRRRERD* |
Ga0066709_1038122902 | 3300009137 | Grasslands Soil | MGGGTMTIVMIVIMVLMMGGMVVGGGWALRRRRRQK* |
Ga0126313_101253682 | 3300009840 | Serpentine Soil | MDMSGALLIVMVVMMVVMMGGMLVGGAWAFIRRRRGHHNRED* |
Ga0126313_102015983 | 3300009840 | Serpentine Soil | MDMGAALTIVMVVMMVVMMGGMVAGGAWAMLRRRKRDEDR* |
Ga0126313_103390131 | 3300009840 | Serpentine Soil | MDGAMTVVMVVMMVVMMGGMVAGGAWAFLRRRRGKHDDR* |
Ga0126313_108546351 | 3300009840 | Serpentine Soil | MGGSTIVTIVMVAMMVVMMGGMLAGGAWAFLRRRRR* |
Ga0131077_1000062026 | 3300009873 | Wastewater | MMDGSTLLTIAMIVMMMVVMMGGMVAGGVWALARRRKRDR* |
Ga0131077_117621372 | 3300009873 | Wastewater | MMDGGTLLTIAMVLMMVVMMGGMVAGGMWALARRRKRDR* |
Ga0126315_105347421 | 3300010038 | Serpentine Soil | MDGAMTVVMVVMMVGMVAGGAWAFLRRRRGKHDDE* |
Ga0126315_109964032 | 3300010038 | Serpentine Soil | MDMSGAMTVVMVVMMVVMMGGMVAGGAWAWMRRRRGKRDEH* |
Ga0126312_100088663 | 3300010041 | Serpentine Soil | MMDMGTALIIVMVVMMGGMLAGGAWATLRRRKRDEDR* |
Ga0126312_104244812 | 3300010041 | Serpentine Soil | MDMSGAITVVMVVMMVVMMGGMMAGGAWALLRRRRGKHDD* |
Ga0126314_103713602 | 3300010042 | Serpentine Soil | MDDAMTVVMVVMMVVMMGGMVAGGAWAFLRRRRGKHDDE* |
Ga0126314_108658922 | 3300010042 | Serpentine Soil | MDGAMTVVMVVMMVVMMGGMVAGGVWAFLRRRRGKHDDR* |
Ga0134082_105304162 | 3300010303 | Grasslands Soil | MGGAMTVVMAVMMGGMLVGGAWAFVRRGKRRRDD* |
Ga0134064_101042902 | 3300010325 | Grasslands Soil | MMGGSTILIIAMGVMMVVMMGGMVVGGIWAVIRRRRR* |
Ga0134080_101937652 | 3300010333 | Grasslands Soil | MIDMGTVLIILMVVMMVVMCGGMIAGGAWAMLRRRKRDGGQ* |
Ga0134080_102841792 | 3300010333 | Grasslands Soil | MDMSGAMTIVVVVMMVVMMGGMLVGGAWAFIRRRRDR* |
Ga0134080_105877391 | 3300010333 | Grasslands Soil | MGALMTIVMVVMMVAMMGGMLVGGAWAFVRRGKRRRDD* |
Ga0138514_1000556061 | 3300011003 | Soil | MDGAMTVVMVVMMVVMMGGMVAGGAWAFLRRRRGKHDDE* |
Ga0137383_102933892 | 3300012199 | Vadose Zone Soil | GRMGGAMTVVMVVMMVLMMGGMLVGGAWAFVRRGKRRRDD* |
Ga0137383_103469642 | 3300012199 | Vadose Zone Soil | MGGAMTVVMVVMMAVMMGGMLVGGAWAFVRRGKRRRDD* |
Ga0137382_107441711 | 3300012200 | Vadose Zone Soil | MGGAMTVVMVVMMVAMMGGMLLGGAWAFVRRGKRRRDD* |
Ga0137382_112903292 | 3300012200 | Vadose Zone Soil | MTGAMPVVMVVMMGGMLAGAAWAFLRRGKRRRDD* |
Ga0137365_104605241 | 3300012201 | Vadose Zone Soil | MDGAMIVAMVVMMVVMMGGMFAGGAWAIIRRRRVKRDEN* |
Ga0137374_108912022 | 3300012204 | Vadose Zone Soil | MTVVMVAMMVVMMGGMVAGGAWALIRRRRGKRDQH* |
Ga0137380_109320852 | 3300012206 | Vadose Zone Soil | MGGAMTVVMVVMMAVMMGGMLVGGAWAFVRRGKRRKSD* |
Ga0137380_114337251 | 3300012206 | Vadose Zone Soil | MRQHGRAMTVVMVVMMVVMMGGMLLGGAWAFVRRGKRRRDN* |
Ga0137381_114765491 | 3300012207 | Vadose Zone Soil | MGGAMTVVMVVMMVVMMGGMLLGGAWAFVRRGKRRRDD* |
Ga0137370_103918262 | 3300012285 | Vadose Zone Soil | MGGAMTVVMVVLMVVMMGGMVGGGAWAVIRRRRGRRDEH* |
Ga0137372_102930242 | 3300012350 | Vadose Zone Soil | MDGATTVVMVVMMVVMMGGMVAGGAWAFLRRRRGKHDDE* |
Ga0137386_109707812 | 3300012351 | Vadose Zone Soil | MGGAMTAVMVVMMVVMMGGMLLAGAWAFVRRGRRRRDD* |
Ga0137366_102777582 | 3300012354 | Vadose Zone Soil | MEGAMTVAMVVMMVVMMGGMFAGGAWAIIRRRRVKRDEN* |
Ga0137369_102198272 | 3300012355 | Vadose Zone Soil | MDGAVNVVMVVMMVVMMGGMIAGGAWAMLRRRRRKDDEH* |
Ga0137371_106609674 | 3300012356 | Vadose Zone Soil | MDGAMTVAMVVMMVVMMGGMFAGGAWAIIRRRRVKRDEN* |
Ga0137371_108498412 | 3300012356 | Vadose Zone Soil | MGGAMTVVMVVMMVVMMGGMLASGAWAFLRRGKQRRDD* |
Ga0137371_110076952 | 3300012356 | Vadose Zone Soil | MDGAMTVVMVVMMVVMMGGMIAGGAWAFLRRRRGKHDDE* |
Ga0137371_113954701 | 3300012356 | Vadose Zone Soil | MGGAMTVVMVVMMVVMMGGMLVGGAWRFVRRGKRRRAD* |
Ga0137368_105427691 | 3300012358 | Vadose Zone Soil | MDMGAALTIVMVVMMGGMVAGGAWAMLRRRKRDEDR* |
Ga0137368_107239072 | 3300012358 | Vadose Zone Soil | MGMSGAMTVVMVVMMVVMMGGMVAGGAWAMLRRRKRDGDR* |
Ga0137375_109094452 | 3300012360 | Vadose Zone Soil | MMDMGAALTIVMVVMMGGMVAGGAWAMLRRRKRDEDG* |
Ga0137375_113134041 | 3300012360 | Vadose Zone Soil | MMDMGGALIIVMVVMMGGMIAGGAWAMLRHRKRHDDR* |
Ga0134087_102549692 | 3300012977 | Grasslands Soil | MGALMTIVMVVMMVAMMGGMLVGGACAFVRRGKRRRDD* |
Ga0120172_10547061 | 3300013765 | Permafrost | MMGGSTILVVAMVLMMVVMMGGMIAGRAWAILRRRRRHDSDE* |
Ga0120181_10511201 | 3300013766 | Permafrost | TVMTIAMIVMMVVMMGGMLVGAGWAFLRRRRQRDR* |
Ga0120158_103981892 | 3300013772 | Permafrost | MMGGSTILVVAMVLMMVVMMGGMIAGGAWAILRRRRRHDSNE* |
Ga0120104_10736802 | 3300014829 | Permafrost | STVMTIAMIVMMVVMMGGMLVGAGWAFLRRRRQRDR* |
Ga0184619_103388781 | 3300018061 | Groundwater Sediment | MMDGSTLLTIAMVVMMVVMMGGMMSGGIWALIRRRKKRDR |
Ga0184637_1000004410 | 3300018063 | Groundwater Sediment | MMDGSTLMTIAMVVMMVVMMGGMVAVGAWALIRRRGKRDR |
Ga0066655_112095212 | 3300018431 | Grasslands Soil | MMGGGAMTVVMIVVMVVMMGGMIAGGAWALVRRRRQRD |
Ga0190275_134366942 | 3300018432 | Soil | MMDGSSLMTIAMVVMMVVMMGGMIAGGAWAFIRRRAKRDR |
Ga0066667_101825623 | 3300018433 | Grasslands Soil | MTGAMTVVMFVMMVVVMGGMLAGAAWAFLRRGKRRRDD |
Ga0066662_103074952 | 3300018468 | Grasslands Soil | MMGGGAMTIAMIVVMVVMMSGMVAGAGRVVARRRRRD |
Ga0066662_103650242 | 3300018468 | Grasslands Soil | MGGSTLMTVAMIAMMVLMMGGMVVGAGWAFVRRRRRRDD |
Ga0066662_106286972 | 3300018468 | Grasslands Soil | MGGAMTVVMVVMMVVMMGGMLLGGAWAFVRRGKRRRDD |
Ga0066669_105022082 | 3300018482 | Grasslands Soil | MGGSTILIIAMGVMMVVMMGGMVVGGIWAVIRRRRR |
Ga0210378_100551443 | 3300021073 | Groundwater Sediment | MGGAMTVVMVAMMVVMMGGMIVGGAWAMIRRHRHHEDRSQQD |
Ga0207661_100129937 | 3300025944 | Corn Rhizosphere | MGGSALVSVPMVLMMVVMMGGMLVGGAWAFLRRRRR |
Ga0209690_10000043 | 3300026524 | Soil | MGGAMTVVMVVMMVVMMGGMLLGGAWAFLRRGKRRRGN |
Ga0209577_100599052 | 3300026552 | Soil | MGGAMTVVMVVMMVLMMGGMLVGGAWALVRRGKRRRDD |
Ga0307292_101263432 | 3300028811 | Soil | MMGGSTLLIIAMVAMIVLMCGGIIAGGAAAFFRRRRR |
Ga0307278_100041504 | 3300028878 | Soil | MDGAVNVVMVVMMVVMMGGMIVGGAWAMLRRRRRKDDEH |
Ga0307278_101429462 | 3300028878 | Soil | MDGAMTVVMVVMMGGMVAGGAWAFLRRRRGDHDDQ |
Ga0307278_103152802 | 3300028878 | Soil | MMGGSTLLTIAMIVMMAVMMGGMVAGGLWALVRRRKRDR |
Ga0307409_1021880182 | 3300031995 | Rhizosphere | MDGAMTVVMVVMMVMMMGGMVAGGTWAFLRRRRGKHDDE |
Ga0334931_000287_7018_7125 | 3300034377 | Sub-Biocrust Soil | MMGGGAMTVVMIVVMVVMMVARAGGAFVRRRRRRD |
⦗Top⦘ |