NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F103795

Metagenome / Metatranscriptome Family F103795

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103795
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 42 residues
Representative Sequence GKTTVNRWKRGDVEFEARGSSHSARNVGQAVDVVLVALKP
Number of Associated Samples 94
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.99 %
% of genes near scaffold ends (potentially truncated) 99.01 %
% of genes from short scaffolds (< 2000 bps) 97.03 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(7.921 % of family members)
Environment Ontology (ENVO) Unclassified
(37.624 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(54.455 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 29.41%    Coil/Unstructured: 70.59%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF13520AA_permease_2 92.08
PF00311PEPcase 1.98
PF07690MFS_1 0.99
PF02781G6PD_C 0.99
PF00587tRNA-synt_2b 0.99
PF01979Amidohydro_1 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG2352Phosphoenolpyruvate carboxylaseEnergy production and conversion [C] 1.98
COG0364Glucose-6-phosphate 1-dehydrogenaseCarbohydrate transport and metabolism [G] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908032|Perma_A_C_ConsensusfromContig36631All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300002561|JGI25384J37096_10158692All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300004643|Ga0062591_102833153All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005330|Ga0070690_100265755All Organisms → cellular organisms → Bacteria1218Open in IMG/M
3300005340|Ga0070689_101631938All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300005364|Ga0070673_100772668All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300005364|Ga0070673_101269318All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300005437|Ga0070710_10300156All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300005467|Ga0070706_101405769All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300005518|Ga0070699_101952323All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300005526|Ga0073909_10715847All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005543|Ga0070672_100329487All Organisms → cellular organisms → Bacteria1299Open in IMG/M
3300005546|Ga0070696_101490060All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300005553|Ga0066695_10430906All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300005554|Ga0066661_10302213All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300005560|Ga0066670_10131551All Organisms → cellular organisms → Bacteria1442Open in IMG/M
3300005576|Ga0066708_10862971All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005616|Ga0068852_102316437All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300005713|Ga0066905_100055906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2448Open in IMG/M
3300005764|Ga0066903_103270171All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300005844|Ga0068862_100230095All Organisms → cellular organisms → Bacteria1681Open in IMG/M
3300006031|Ga0066651_10462738All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300006042|Ga0075368_10113241All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300006049|Ga0075417_10478753All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300006173|Ga0070716_100126603All Organisms → cellular organisms → Bacteria1608Open in IMG/M
3300006578|Ga0074059_12066949All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300006796|Ga0066665_10262556All Organisms → cellular organisms → Bacteria1372Open in IMG/M
3300006881|Ga0068865_101490730All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300006903|Ga0075426_10682987All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300007076|Ga0075435_100358586All Organisms → cellular organisms → Bacteria1250Open in IMG/M
3300007076|Ga0075435_100481422All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300007076|Ga0075435_101140857All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300009012|Ga0066710_100932470All Organisms → cellular organisms → Bacteria1338Open in IMG/M
3300009088|Ga0099830_10378400All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300009089|Ga0099828_11160028All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300009098|Ga0105245_11121933All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300009101|Ga0105247_10440810All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300009101|Ga0105247_10889873All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300009147|Ga0114129_10724137All Organisms → cellular organisms → Bacteria1276Open in IMG/M
3300009156|Ga0111538_10012020All Organisms → cellular organisms → Bacteria11444Open in IMG/M
3300009177|Ga0105248_10202609All Organisms → cellular organisms → Bacteria2236Open in IMG/M
3300010304|Ga0134088_10544623All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300010323|Ga0134086_10151281All Organisms → cellular organisms → Bacteria → Acidobacteria847Open in IMG/M
3300010329|Ga0134111_10295226All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300010329|Ga0134111_10345566All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300010360|Ga0126372_12397081All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300010401|Ga0134121_10652833All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300010403|Ga0134123_10505897All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300010403|Ga0134123_10967010All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300011271|Ga0137393_10677352All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300012199|Ga0137383_10187282All Organisms → cellular organisms → Bacteria1517Open in IMG/M
3300012349|Ga0137387_11015855All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300012908|Ga0157286_10074072All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300012912|Ga0157306_10104075All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300012977|Ga0134087_10580192All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300012989|Ga0164305_11014168All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300015201|Ga0173478_10479374All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300015245|Ga0137409_11280675All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300015371|Ga0132258_12389389All Organisms → cellular organisms → Bacteria1324Open in IMG/M
3300015372|Ga0132256_101128465All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300015373|Ga0132257_102126625All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300015374|Ga0132255_100511873All Organisms → cellular organisms → Bacteria1765Open in IMG/M
3300017947|Ga0187785_10093422All Organisms → cellular organisms → Bacteria1193Open in IMG/M
3300017961|Ga0187778_11043576All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300018431|Ga0066655_10100607All Organisms → cellular organisms → Bacteria1619Open in IMG/M
3300022756|Ga0222622_10674867All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300024219|Ga0247665_1072563All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300025900|Ga0207710_10416192All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300025903|Ga0207680_10660060All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300025906|Ga0207699_10810768All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300025908|Ga0207643_10149032All Organisms → cellular organisms → Bacteria1401Open in IMG/M
3300025910|Ga0207684_11133868All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300025925|Ga0207650_10415179All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300025926|Ga0207659_10682222All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300025931|Ga0207644_11062451All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300025935|Ga0207709_11219767All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300025939|Ga0207665_10158519All Organisms → cellular organisms → Bacteria1626Open in IMG/M
3300025940|Ga0207691_10324021All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300025941|Ga0207711_10826032All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300025941|Ga0207711_11875661All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300025986|Ga0207658_11411214All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300026023|Ga0207677_11143040All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300026142|Ga0207698_10371254All Organisms → cellular organisms → Bacteria1358Open in IMG/M
3300026557|Ga0179587_11171887All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300027903|Ga0209488_11127765All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300028380|Ga0268265_10167608All Organisms → cellular organisms → Bacteria1873Open in IMG/M
3300028381|Ga0268264_12680315All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300028881|Ga0307277_10215743All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300031184|Ga0307499_10261988All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300031548|Ga0307408_101957945All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300031562|Ga0310886_11057338All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300031731|Ga0307405_10181558All Organisms → cellular organisms → Bacteria1511Open in IMG/M
3300031736|Ga0318501_10682948All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300031942|Ga0310916_10698105All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300031943|Ga0310885_10520334All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300031981|Ga0318531_10263622All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300032051|Ga0318532_10186070All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300032205|Ga0307472_100509194All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300032275|Ga0315270_11111956All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300033290|Ga0318519_10197713All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300033412|Ga0310810_11439696All Organisms → cellular organisms → Bacteria520Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.93%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere5.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.95%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.98%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.98%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.99%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.99%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.99%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.99%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908032Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_allEnvironmentalOpen in IMG/M
3300002561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cmEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024219Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Perma_A_C_026023702124908032SoilNRWTRGDVEFEGLGTSHSARNVGGAVDVVLVALKPQ
JGI25384J37096_1015869213300002561Grasslands SoilNGKTTVNRWKRGDVEFEARGSSHSARNVGKAVDVVLVALKQ*
Ga0062591_10283315313300004643SoilKTAVNRWKRGDVEFEGLGSSHSARNVGGAVDVVLVALKP*
Ga0070690_10026575513300005330Switchgrass RhizosphereGKTKVNRWKHGDVEFEGRGSSHSARNLGPAVEAILVTLKP*
Ga0070689_10163193813300005340Switchgrass RhizosphereTTKVNHFKPGDVEFESRGSSHSARNAGQAVDVVLVALKP*
Ga0070673_10077266823300005364Switchgrass RhizosphereADGKTVVNRWKRGDVEFESIGSSHSARNVGSAVDVVLVALKPQ*
Ga0070673_10126931823300005364Switchgrass RhizosphereDGKTVVNRWKPGDVEFESLGSSHSARNVGKPVEVVLVALKP*
Ga0070710_1030015623300005437Corn, Switchgrass And Miscanthus RhizosphereIEDTANGKTVVNKWKPGDVEYEALGSSHSARNVGGPVDVVLVALK*
Ga0070706_10140576913300005467Corn, Switchgrass And Miscanthus RhizosphereDTAAGNTKVNRWKHGDVEFEAAGSSHSARNLGPAVDAVLVTLKP*
Ga0070699_10195232313300005518Corn, Switchgrass And Miscanthus RhizosphereSDGKTVVNRWKRGDVEFEGLGTSHSARNVGGAVDVVLVALKPR*
Ga0073909_1071584723300005526Surface SoilDTADGKTIVNRWKRGDVEFESLGSSHSARNVGGAVDVVLVALKPQ*
Ga0070672_10032948713300005543Miscanthus RhizosphereIVNRWKPGDVEFESRGSSHSARNISHPVDVVLVALKP*
Ga0070696_10149006013300005546Corn, Switchgrass And Miscanthus RhizosphereEDTANGKTVVNRWKPGDVEFESRGSSHSARNISHPVDVVLVALKP*
Ga0066695_1043090613300005553SoilNGKTVVNKWKPGDVEFEGRGSSHSARNIGKPIDVVLVALK*
Ga0066661_1030221323300005554SoilGKTVVNRWKPGDVEFEARGSSHSARNVGQPISVVLVELKP*
Ga0066670_1013155113300005560SoilRWKPGDVEFEARGSSHSARNVGQPISVVLVELKP*
Ga0066708_1086297113300005576SoilGGEIEDTANGKTVVNRWKRGDVELEGLGTSHSARNVAGPVDVVLVALKP*
Ga0068852_10231643713300005616Corn RhizosphereIEDTADGKTVVNRWKRGDVEFEGLGTSHSARNVGGAVDVVLVALKPQ*
Ga0066905_10005590613300005713Tropical Forest SoilDGKTKVNRWSRGDVELETKGSSHSARNVGKAVDVFLVALKP*
Ga0066903_10327017113300005764Tropical Forest SoilRWTRGDVEFEGRGTSHSARNAGGAVDVVLVVLKP*
Ga0068862_10023009513300005844Switchgrass RhizosphereIEDTANGKTAVNRWKHGDVEFEGLGSSHSARNVGPAVDVVLIALKP*
Ga0066651_1046273813300006031SoilVNRWKPGDVELESRGSSHAARNVGEAIDVVLVAFKP*
Ga0075368_1011324123300006042Populus EndosphereIEDTADGKTKVNRWKHGDVEFEGRGSSHSARNLGPAVEAILVTLKP*
Ga0075417_1047875323300006049Populus RhizosphereTKVNRWKRGDVEFEGRGTSHSARNAGGAIDVVLVTLKP*
Ga0070716_10012660313300006173Corn, Switchgrass And Miscanthus RhizosphereNRWTRGDVEFEGRGTSHSARNVGGAVDVVLVALKP*
Ga0074059_1206694923300006578SoilTIVNRWKPGDVEFESRGSSHSARNISHPVDVVLVALKP*
Ga0066665_1026255623300006796SoilEDTANGKTVVNKWKPGDVEFEGRGSSHSARNIGKPIDVVLVALK*
Ga0068865_10149073013300006881Miscanthus RhizosphereADGKTVVNRWKPGDVEFESLGSSHSARNVGKPVEVVLVALKP*
Ga0075426_1068298723300006903Populus RhizosphereDGRTVVNRWTRGDVEFEGRGTSHSARNVGGAVDVVLVALKP*
Ga0075435_10035858613300007076Populus RhizosphereGKTVVNRWTRGDVEFEGRGTSHSARNVGGAVDVVLVALKP*
Ga0075435_10048142223300007076Populus RhizosphereADGKTIVNRWKRGDAEFEAFGSSHSARNVGAAVDVVLVALKP*
Ga0075435_10114085713300007076Populus RhizosphereIEDTADGKTIVNRWKPGDVEFEARGSSHSARNLSHAVDVVLVVLKH*
Ga0066710_10093247023300009012Grasslands SoilNRWKPGDVEFEARGSSHSARNVSHPIDVVLVELKP
Ga0099830_1037840013300009088Vadose Zone SoilIEDTANGTTKVNRWKPGDVEFESRGSSHSARNVGPAIDVVLVALKP*
Ga0099828_1116002823300009089Vadose Zone SoilTADGKTKVNRWEHGDVEFEARGSSHSARNLGAAVDVVLVALKP*
Ga0105245_1112193313300009098Miscanthus RhizosphereRWKRGDVEFESVGSSHSARNVGGAVDVVLVALKPQ*
Ga0105247_1044081023300009101Switchgrass RhizosphereGGEIEDTANGKTVVNRWKRGDVEFESLGSSHSARNAGGAVDVVLVVLKP*
Ga0105247_1088987313300009101Switchgrass RhizosphereEDTANGKTTVNRWKHGDVEFEIRGSSHSARNVGQAVDVVLVALKP*
Ga0114129_1072413713300009147Populus RhizosphereEDTADGKTIVNRWTRGDVEFEARGSSHSARNLGKPVDVFLVALKP*
Ga0111538_1001202013300009156Populus RhizosphereDGKTKVNRWKHGDVEFEGRGSSHSARNLGPAVEAILVTLKP*
Ga0105248_1020260913300009177Switchgrass RhizosphereTVVNRWKRGDVEFESLGSSHSARNVGGAVDVVLVALKPQ*
Ga0134088_1054462323300010304Grasslands SoilNRWKPGDVEFEARGSSHSARNVSHPIDVVLVELKP*
Ga0134086_1015128123300010323Grasslands SoilVNRWKPGDVELESRGSSHSARNVGEAIDVVLVALKR*
Ga0134111_1029522613300010329Grasslands SoilKTVVNRWQRGDVEFEGRGTSHSARNVGGAVDVVLVALKQSSAVVR*
Ga0134111_1034556623300010329Grasslands SoilEIEDTANGRTIVNRWKPGDVEFESRGSSHSARNISQPVDVVLVALKP*
Ga0126372_1239708123300010360Tropical Forest SoilGKTVVNRPRRGDVEFESKGSSHSARNLGAAVDVVLVTLKP*
Ga0134121_1065283313300010401Terrestrial SoilNRWKHGDVEFEALGSSHSARNVGPAVDVVLVALKP*
Ga0134123_1050589713300010403Terrestrial SoilTVNRWKRGDVEFEARGSSHSARNVGQAVDVVLVALKP*
Ga0134123_1096701013300010403Terrestrial SoilDTANGKTIVNRWKPGDVEFESRGSSHSARNISHPVDVVLVALKP*
Ga0137393_1067735213300011271Vadose Zone SoilHWKHGDVEFEGRGSSHSARNLGPAVDVVLVTLKP*
Ga0137383_1018728213300012199Vadose Zone SoilDGKTVVNRWKRGDVELEGIGTSHSARNVGGAVDVVLVALKPSSVVSR*
Ga0137387_1101585513300012349Vadose Zone SoilNRWKRGDVEFEGIGTSHSARNVGGAVDVVLVALKQSSVVGR*
Ga0157286_1007407213300012908SoilTADGQTKVNRWVPGDVEFEARGSSHSARNIGKAVDVVLVALKP*
Ga0157306_1010407523300012912SoilRWKHGDVEFEGRGSSHSARNLGPAVEAILVTLKP*
Ga0134087_1058019213300012977Grasslands SoilADAVEDTAEGRTKVNRWKRGDVEFEGRGTSHSARNAGGAIDVVLVTLKP*
Ga0164305_1101416813300012989SoilIEDTANGKTIVNRWKPGDVEFESRGSSHSARNISHPVDVVLVALKP*
Ga0173478_1047937413300015201SoilSIEDTADGKTRVNHWKHGDVEFEGRGSSHSARNLGPAVDAILVTLKP*
Ga0137409_1128067523300015245Vadose Zone SoilWKRGDVEFEGLGTSHSARNVGGAVDVVLVALKPQ*
Ga0132258_1238938923300015371Arabidopsis RhizosphereVVNRWKRGDVEFEGLGTSHSARNVGGAVDVVLVALKPQ*
Ga0132256_10112846513300015372Arabidopsis RhizosphereGKTKVNRWKHGDVEFEGRGTSHSARNLGPAVEDILVTLKP*
Ga0132257_10212662513300015373Arabidopsis RhizosphereDTADGKTVVNRWKRGDVEFEGLGSSHSARNVAGAVDVVLVVLKRP*
Ga0132255_10051187333300015374Arabidopsis RhizosphereKTIVNRWTPGDVEFESRGSSHSARNISHPVDVVLVALKP*
Ga0187785_1009342223300017947Tropical PeatlandDTADGKTVAKHWKHGDVEFEARGSSHSARNLGPAVEVVLVRLKP
Ga0187778_1104357623300017961Tropical PeatlandADGKTQVKRWAHGDVEFEARGTSHSARNAGKAVDVVLVTLKP
Ga0066655_1010060733300018431Grasslands SoilDTAEGRTKVNRWKRGDVEFEGRGTSHSARNAGGAIDVVLVTLKP
Ga0222622_1067486713300022756Groundwater SedimentGKTTVNRWKRGDVEFEARGSSHSARNVGQAVDVVLVALKP
Ga0247665_107256313300024219SoilNRWKRGDVEFESVGSSHSARNVGGAVDVVLVALKPQ
Ga0207710_1041619213300025900Switchgrass RhizosphereGGEIEDTANGKTVVNRWKRGDVEFESLGSSHSARNAGGAVDVVLVVLKP
Ga0207680_1066006013300025903Switchgrass RhizosphereESEDTANGKTIVNRWKPGDVEFESRGSSHSARNISDPVDVVLVALKP
Ga0207699_1081076823300025906Corn, Switchgrass And Miscanthus RhizosphereVNKWKPGDVEYEALGSSHSARNVGGPVDVVLVALK
Ga0207643_1014903213300025908Miscanthus RhizosphereIEDTADGKTKVNRWKHGDVEFEGRGSSHSARNLGPAVEAILVTLKP
Ga0207684_1113386823300025910Corn, Switchgrass And Miscanthus RhizosphereGTILDTAAGNTKVNRWKHGDVEFEAAGSSHSARNLGPAVDAVLVTLKP
Ga0207650_1041517913300025925Switchgrass RhizosphereEIEDSADGKTVVNRWKRGDVEFEGLGTSHSARNVGGAVDVVLVALKRQ
Ga0207659_1068222213300025926Miscanthus RhizosphereIEDTANGKTIVNRWKPGDVEFESRGSSHSARNISHPVDVVLVAVKP
Ga0207644_1106245123300025931Switchgrass RhizosphereNGKTIVNRWKPGDVEFESRGSSHSARNISHPVDVVLVALKP
Ga0207709_1121976713300025935Miscanthus RhizosphereGGEIEDTADGKTVVNRWKRGDVEFEGIGTSHSARNVGGAVDVVLVALKSQ
Ga0207665_1015851933300025939Corn, Switchgrass And Miscanthus RhizosphereNRWTRGDVEFEGRGTSHSARNVGGAVDVVLVALKP
Ga0207691_1032402113300025940Miscanthus RhizosphereDTANGKTIVNRWKPGDVEFESRGSSHSARNISHPVDVVLVALKP
Ga0207711_1082603213300025941Switchgrass RhizosphereVVNRWKRGDVEFESLGSSHSARNVGGAVDVVLVALKPQ
Ga0207711_1187566123300025941Switchgrass RhizosphereGEIEDTADGKTSVNRWKRGDVEFESVGSSHSARNVGGAVDVVLVALKPQ
Ga0207658_1141121423300025986Switchgrass RhizosphereGKTIVNRWKRGDVEFESVGSSHSARNVGGAVDVVLVALKPQ
Ga0207677_1114304023300026023Miscanthus RhizosphereKTVVNRWKRGDVEFESLGSSHSARNAGGAVDVVLVVLKP
Ga0207698_1037125413300026142Corn RhizosphereNRWKRGDAEFEAFGSSHSARNVGAAVDVVLVALKP
Ga0179587_1117188713300026557Vadose Zone SoilTSDGKTVVNRWKRGDVEFEGLGTSHSARNVGGAVDVVLVVLKPQ
Ga0209488_1112776523300027903Vadose Zone SoilRVNRWKPGDVEFESRGSSHSARNVGQAVDVVLVVLKP
Ga0268265_1016760813300028380Switchgrass RhizosphereSIEDTANGKTAVNRWKHGDVEFEGLGSSHSARNVGPAVDVVLIALKP
Ga0268264_1268031523300028381Switchgrass RhizosphereGKTVVNRWKRGDVEFEGLGTSHSARNVGGAVDVVLVALKRQ
Ga0307277_1021574313300028881SoilNGKTTVNRWKHGDVEFEARGSSHSARNVGQAVDVVLVALKP
Ga0307499_1026198813300031184SoilRWKRGDVEFEGLGTSHSARNVGGAVDVVLVALKRP
Ga0307408_10195794513300031548RhizosphereTVVNRWKPGDVEFEGRGSSHSARNMGSPVDVVLVALKP
Ga0310886_1105733813300031562SoilRHWKPGDVEFEGRGTSHSAKNLGAAIDVVLVVLKPR
Ga0307405_1018155823300031731RhizosphereVNRWKPGDVEFEAQGSSHSARNVSHPVDVVLVALKP
Ga0318501_1068294823300031736SoilGKTAVNRWRSGDVEFEARGSSHSARNVSHPVDVVLVALKP
Ga0310916_1069810513300031942SoilTVVNRWKRGDVEFESLGSSHSARNVGGAVDVVLVVLKPQ
Ga0310885_1052033423300031943SoilEIEDTANGKTIVNRWKPGDVEFESRGSSHSARNISHPVDVVLVALKP
Ga0318531_1026362223300031981SoilIEDTANGKTAVNRWRSGDVEFEARGSSHSARNVSHPVDVVLVALKP
Ga0318532_1018607023300032051SoilIEDTAGGKTNVNRWKPGDVEFEARGSSHSARNVGQAVDVVLVRLEP
Ga0307472_10050919413300032205Hardwood Forest SoilTADGKTVVNRWKRGDVEFEGLGSSHSARNAGGAVDVVLVVLKPE
Ga0315270_1111195613300032275SedimentEIEDTADGKTVVNRWKRGDVEFEGLGTSHSARNVGGAVDVVLVALKPR
Ga0318519_1019771313300033290SoilNRWKRGDVEFESLGSSHSARNVGGAVDVVLVVLKPQ
Ga0310810_1143969623300033412SoilGEIEDTADGKTVVNRWKRGDVEFEGLGTSHSARNVGAAVDVVLVALKRQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.