NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F103757

Metagenome / Metatranscriptome Family F103757

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103757
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 43 residues
Representative Sequence FEQLYNGEDAVSRVFLDVIQRDLVATLRETLRPHARLAASV
Number of Associated Samples 92
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 94.06 %
% of genes from short scaffolds (< 2000 bps) 98.02 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (61.386 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(12.871 % of family members)
Environment Ontology (ENVO) Unclassified
(33.663 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(51.485 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 52.17%    β-sheet: 0.00%    Coil/Unstructured: 47.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF00266Aminotran_5 8.91
PF00248Aldo_ket_red 6.93
PF01019G_glu_transpept 5.94
PF00196GerE 4.95
PF10099RskA 4.95
PF07690MFS_1 3.96
PF03176MMPL 2.97
PF00563EAL 2.97
PF08281Sigma70_r4_2 1.98
PF00211Guanylate_cyc 1.98
PF13191AAA_16 0.99
PF00583Acetyltransf_1 0.99
PF14340DUF4395 0.99
PF12680SnoaL_2 0.99
PF00353HemolysinCabind 0.99
PF05977MFS_3 0.99
PF00909Ammonium_transp 0.99
PF16952Gln-synt_N_2 0.99
PF00027cNMP_binding 0.99
PF14681UPRTase 0.99
PF12829Mhr1 0.99
PF06348DUF1059 0.99
PF00990GGDEF 0.99
PF12681Glyoxalase_2 0.99
PF13487HD_5 0.99
PF00171Aldedh 0.99
PF00370FGGY_N 0.99
PF08443RimK 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 5.94
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 2.97
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 2.97
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 2.97
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 2.97
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 2.97
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 2.97
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 1.98
COG0004Ammonia channel protein AmtBInorganic ion transport and metabolism [P] 0.99
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.99
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.99
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.99
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms61.39 %
UnclassifiedrootN/A38.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_112211159Not Available649Open in IMG/M
3300002568|C688J35102_120863341All Organisms → cellular organisms → Bacteria1882Open in IMG/M
3300004081|Ga0063454_101262849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria616Open in IMG/M
3300004114|Ga0062593_100022096All Organisms → cellular organisms → Bacteria3395Open in IMG/M
3300004157|Ga0062590_100185588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1481Open in IMG/M
3300005339|Ga0070660_100718605Not Available838Open in IMG/M
3300005341|Ga0070691_10315468Not Available858Open in IMG/M
3300005364|Ga0070673_100899354Not Available821Open in IMG/M
3300005406|Ga0070703_10261923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria706Open in IMG/M
3300005438|Ga0070701_10642487Not Available707Open in IMG/M
3300005466|Ga0070685_11190249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M
3300005468|Ga0070707_101970058Not Available552Open in IMG/M
3300005563|Ga0068855_101005681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria876Open in IMG/M
3300005564|Ga0070664_101701931Not Available598Open in IMG/M
3300005764|Ga0066903_106417461Not Available613Open in IMG/M
3300005834|Ga0068851_10147356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1284Open in IMG/M
3300005844|Ga0068862_100616099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1044Open in IMG/M
3300006173|Ga0070716_100966677All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300006173|Ga0070716_101213355All Organisms → cellular organisms → Bacteria → Terrabacteria group606Open in IMG/M
3300006175|Ga0070712_101337190All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300006578|Ga0074059_10195590Not Available513Open in IMG/M
3300006804|Ga0079221_10706172All Organisms → cellular organisms → Bacteria → Terrabacteria group703Open in IMG/M
3300006844|Ga0075428_101731421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria652Open in IMG/M
3300006846|Ga0075430_101079812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria661Open in IMG/M
3300006953|Ga0074063_13330499All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300007004|Ga0079218_11700527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria699Open in IMG/M
3300009094|Ga0111539_10128121All Organisms → cellular organisms → Bacteria2973Open in IMG/M
3300009137|Ga0066709_103529551Not Available567Open in IMG/M
3300009147|Ga0114129_12682009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300009148|Ga0105243_10528534Not Available1123Open in IMG/M
3300009176|Ga0105242_11346221All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300009789|Ga0126307_10231316Not Available1485Open in IMG/M
3300009789|Ga0126307_10816112Not Available753Open in IMG/M
3300010040|Ga0126308_11158323Not Available546Open in IMG/M
3300010042|Ga0126314_10732528Not Available725Open in IMG/M
3300010044|Ga0126310_10076979All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1951Open in IMG/M
3300010045|Ga0126311_11596705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300010322|Ga0134084_10096944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium936Open in IMG/M
3300010375|Ga0105239_13295013All Organisms → cellular organisms → Bacteria → Terrabacteria group526Open in IMG/M
3300012208|Ga0137376_11460588All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300012285|Ga0137370_10505360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium740Open in IMG/M
3300012356|Ga0137371_11357838Not Available523Open in IMG/M
3300012469|Ga0150984_116043961Not Available893Open in IMG/M
3300012951|Ga0164300_10166347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1049Open in IMG/M
3300012984|Ga0164309_10433355Not Available989Open in IMG/M
3300012987|Ga0164307_10354923Not Available1065Open in IMG/M
3300012988|Ga0164306_10118684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1757Open in IMG/M
3300012988|Ga0164306_10976373Not Available696Open in IMG/M
3300013105|Ga0157369_12179710Not Available562Open in IMG/M
3300013296|Ga0157374_10582569All Organisms → cellular organisms → Bacteria → Terrabacteria group1128Open in IMG/M
3300013297|Ga0157378_11042753All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium853Open in IMG/M
3300013306|Ga0163162_12441231All Organisms → cellular organisms → Bacteria → Terrabacteria group601Open in IMG/M
3300014150|Ga0134081_10348557All Organisms → cellular organisms → Bacteria → Terrabacteria group543Open in IMG/M
3300014487|Ga0182000_10662653Not Available511Open in IMG/M
3300014969|Ga0157376_10953145All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300015356|Ga0134073_10387400Not Available523Open in IMG/M
3300015371|Ga0132258_11729607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1577Open in IMG/M
3300015374|Ga0132255_105721209Not Available526Open in IMG/M
3300018432|Ga0190275_11064393Not Available882Open in IMG/M
3300018469|Ga0190270_10663935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1028Open in IMG/M
3300018469|Ga0190270_11363287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria754Open in IMG/M
3300025899|Ga0207642_10653069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300025901|Ga0207688_10595451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria696Open in IMG/M
3300025905|Ga0207685_10584016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia598Open in IMG/M
3300025911|Ga0207654_10447081Not Available906Open in IMG/M
3300025919|Ga0207657_10511979Not Available940Open in IMG/M
3300025922|Ga0207646_11187886Not Available669Open in IMG/M
3300025927|Ga0207687_11783986All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium527Open in IMG/M
3300025928|Ga0207700_10714510All Organisms → cellular organisms → Bacteria → Terrabacteria group895Open in IMG/M
3300025928|Ga0207700_11141622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia696Open in IMG/M
3300025931|Ga0207644_10906689All Organisms → cellular organisms → Bacteria → Terrabacteria group739Open in IMG/M
3300025938|Ga0207704_11813682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium525Open in IMG/M
3300025939|Ga0207665_10831295All Organisms → cellular organisms → Bacteria → Terrabacteria group731Open in IMG/M
3300025942|Ga0207689_10244057All Organisms → cellular organisms → Bacteria1485Open in IMG/M
3300025944|Ga0207661_11981976Not Available528Open in IMG/M
3300026041|Ga0207639_11726650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300026067|Ga0207678_10257883All Organisms → cellular organisms → Bacteria → Proteobacteria1494Open in IMG/M
3300026075|Ga0207708_10739801Not Available843Open in IMG/M
3300027787|Ga0209074_10036389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1437Open in IMG/M
3300027897|Ga0209254_10703375Not Available697Open in IMG/M
3300028589|Ga0247818_11173542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300028589|Ga0247818_11205959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300028597|Ga0247820_11113528All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300028608|Ga0247819_10871396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300028889|Ga0247827_10945365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M
3300030336|Ga0247826_10412736Not Available1000Open in IMG/M
3300031366|Ga0307506_10409968Not Available557Open in IMG/M
3300031544|Ga0318534_10717617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300031546|Ga0318538_10317356All Organisms → cellular organisms → Bacteria → Terrabacteria group840Open in IMG/M
3300031547|Ga0310887_10258802Not Available974Open in IMG/M
3300031731|Ga0307405_11268047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria640Open in IMG/M
3300031792|Ga0318529_10400610Not Available639Open in IMG/M
3300031820|Ga0307473_10856175Not Available653Open in IMG/M
3300031890|Ga0306925_10328712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1643Open in IMG/M
3300031996|Ga0308176_12071271All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300031996|Ga0308176_12866774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium512Open in IMG/M
3300032002|Ga0307416_100555525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1222Open in IMG/M
3300032002|Ga0307416_100760729Not Available1062Open in IMG/M
3300032002|Ga0307416_102584005Not Available606Open in IMG/M
3300032401|Ga0315275_12074495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium597Open in IMG/M
3300033551|Ga0247830_10194434Not Available1511Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere12.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil9.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.91%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil5.94%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.97%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.97%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.98%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.99%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.99%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.99%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.99%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.99%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_11221115913300000956SoilLVLPRDLFEQLFNGEDAVSRGFLDVIQKDLVATLRETLRPCARLAASV*
C688J35102_12086334133300002568SoilFARLFHSEDAVSRVFLEAIQRDLLATLRQALRPYARLTASV*
Ga0063454_10126284913300004081SoilAILLVLPRDVFARLFHSEDAVSRVFLEAIQRDLLATLRQTLRPYARLTASV*
Ga0062593_10002209613300004114SoilILLVLPRDPFDKLFNGEDAVSRGLLDVIQRDLTATLRETFRPCARLAASV*
Ga0062590_10018558833300004157SoilPFDKLFNGEDAVSRGLLDVIQRDLTATLRETFRPCARLAASV*
Ga0070660_10071860523300005339Corn RhizosphereVLPRDVFARLFHSEDAVSRVFLEAIQRDLLATLRQTLRPLARLTASV*
Ga0070691_1031546813300005341Corn, Switchgrass And Miscanthus RhizosphereFDQLFRREDAISRVFLDVIQRDLVATLRQSLRPHARLAASV*
Ga0070673_10089935413300005364Switchgrass RhizosphereLPREPFDQLFRREDAISRVFLDVIQRDLVATLRQSLRPHARLAASV*
Ga0070703_1026192323300005406Corn, Switchgrass And Miscanthus RhizosphereQLFHREDAISRVFLDVIQRDLVATLRQSLRPHARLAASV*
Ga0070701_1064248723300005438Corn, Switchgrass And Miscanthus RhizosphereRAILLVLPRDPFDQLFNGEDAVSRGLLDVIQRDLTATLRETFRPCARLAASI*
Ga0070685_1119024913300005466Switchgrass RhizosphereEHFDQLFHKEDAVARVFLEAIQRDLLASLRQTLRPAARLAASV*
Ga0070707_10197005823300005468Corn, Switchgrass And Miscanthus RhizosphereMAEQLFNAEDAVSRVFLDVIQRDLVATLRETSRPNARLSASV*
Ga0068855_10100568113300005563Corn RhizosphereLPREPFDQLFHREDAISRVFLDVIQRDLVATLRQSLRPHARLAASV*
Ga0070664_10170193123300005564Corn RhizosphereFEQLYNGEDAVSRVFLDVIQRDLVATLRETLRPHARLAASV*
Ga0066903_10641746113300005764Tropical Forest SoilLLVLARDPFEQLYNRNDTIARLFLDVLLRDLVATVRLTLRPHARLAASV*
Ga0068851_1014735623300005834Corn RhizosphereEDAISRVFLDVIQRDLVATLRQSLRPHARLAASV*
Ga0068862_10061609923300005844Switchgrass RhizosphereVFARLFHSEDAVSRVFLEAIQRDLLAMLRQTLRPYARLTASV*
Ga0070716_10096667733300006173Corn, Switchgrass And Miscanthus RhizosphereAVTRERSLLLVLPRAHFEQLFNGENAVSRVFLEVLQRDQVATLRQTLRPHARLAASL*
Ga0070716_10121335523300006173Corn, Switchgrass And Miscanthus RhizosphereVLPSDRFTQLFHGEDAVSRVFLDVIQRELVATLRQTLRPHARLAASL*
Ga0070712_10133719013300006175Corn, Switchgrass And Miscanthus RhizosphereREDAISRVFLDVIQRDLVATLRQSLRPHARLAASV*
Ga0074059_1019559013300006578SoilPRDPFEQLFNGENAVSRVFLEVLQRDQVATLRQTLRPHARLAASL*
Ga0079221_1070617213300006804Agricultural SoilVLPRDRFTQLFHGEDAVSRVFLDVIQRELVATLRQTLRPHARLAASL*
Ga0075428_10173142113300006844Populus RhizospherePRDLFGKLFDGEDAVSRGFLDVIQKDLMATLRETLRPCARLAARAP*
Ga0075430_10107981213300006846Populus RhizosphereVTPSSSFLDREDAVSRVFLDVIQLDLVATLRQHARLAASV*
Ga0074063_1333049933300006953SoilHGPFEQLYNGEDAVSRVFLDVIRRELVATLRQTLRQQARLEASV*
Ga0079218_1170052723300007004Agricultural SoilVPRDLFEQLFNGEDAVSRGFLDVIQKDLMATLRDTLRPCARLAASG*
Ga0111539_1012812153300009094Populus RhizosphereVLPRDVFARLFHSEDAVSRVFLEAIQRDLLAMLRQTLRPYARLTASV*
Ga0066709_10352955113300009137Grasslands SoilPRDPFEQLFNGEDAVSRVFLDVIQRDLVATLRQTLRPNARLAASV*
Ga0114129_1268200923300009147Populus RhizosphereVTPSSSFLDGEDAVSRVFLDVIQLDLVATLRQTLRPHARLAASL*
Ga0105243_1052853413300009148Miscanthus RhizosphereQLFRREDAISRVFLDVIQRDLVATLRQSLRPHARLAASV*
Ga0105242_1134622113300009176Miscanthus RhizosphereVLPRGPFDQLFNGEDAVSRVFLDVIQRELVATLRQTLRQHARLAASV*
Ga0126307_1023131623300009789Serpentine SoilLLLVVRGDLFQRLFNGEDAVSRGFLDVIQRDLMATLRETLRPCARLAASGS*
Ga0126307_1081611223300009789Serpentine SoilGEDAVSRGFLDVIQKDLVATLRETLRPCARLAASG*
Ga0126308_1115832323300010040Serpentine SoilFDKDDAVGRVFLDAIQRDLLATLRQALRPYARVAASV*
Ga0126314_1073252813300010042Serpentine SoilEQLFNGEDAVSRGFLDVIQKDLVATLRETLRPCARLAASG*
Ga0126310_1007697923300010044Serpentine SoilFNGEDAVSRVFLDVIQRELVAALRQPLRQYARLAASV*
Ga0126311_1159670513300010045Serpentine SoilLLYKEDAVGRVFLEAIQRDLLATVRRTLRPCARLAASL*
Ga0134084_1009694433300010322Grasslands SoilPSDVFEQLFHREDAISRVFLEAIQRDLLVTLRHALRPSARLASSV*
Ga0105239_1329501323300010375Corn RhizospherePRDHFEQLYNGEDAVSRVFLDVIQRDLVATLRETLRPHARLAASV*
Ga0137376_1146058823300012208Vadose Zone SoilLFNGEDAVSRVFLDVIHRELVATLRQTLRPHARLAASV*
Ga0137370_1050536013300012285Vadose Zone SoilLAREPFGQLFAREDTISEVFLDVILRDLAATLRQTLRPHARLASSV*
Ga0137371_1135783823300012356Vadose Zone SoilVLARESFGQLFEGEDTISEVFLDVILRDLAATLRQTLRPHARLASSV*
Ga0150984_11604396123300012469Avena Fatua RhizosphereGEDAVSRVFLDVIRRDLLATLRQTLRPHARLAASV*
Ga0164300_1016634723300012951SoilERSLLLVLPREPFEQLFHREDAISRVFLDVIQRDLVATLRQSLRPHARLAASV*
Ga0164309_1043335513300012984SoilFDTLFAGEDAVSRVILDVIQADLVATLRQTLRPQARLSASL*
Ga0164307_1035492323300012987SoilFDRRFHNEDAVSRVFLEAIHRDLLATLRQTLRPCARLTPSV*
Ga0164306_1011868413300012988SoilEQLFHREDAISRVFLDVIQRDLVATLRQSLRPHARLAASV*
Ga0164306_1097637323300012988SoilFVLPSDRFTQLFHGEDAVSRVFLDVIQRELVATLRQTLRPHARLAASL*
Ga0157369_1217971023300013105Corn RhizosphereFRREDAISRVFLDVIQRDLVATLRQSLRPHARLAASV*
Ga0157374_1058256933300013296Miscanthus RhizosphereRREDAISRVFLDVIQRDLVATLRQSLRPHARLAASV*
Ga0157378_1104275323300013297Miscanthus RhizosphereLAIARENFAELFHREDAIARVFLDLLLRELVATLRITLRPHARLAASI*
Ga0163162_1244123123300013306Switchgrass RhizosphereFHGEDAVSRVFLDVIQRELVATLRQTLRPHARLAASL*
Ga0134081_1034855723300014150Grasslands SoilLVLPRGPFEELFNGEDAVSRGLLDVIQRDLMATLRATFRPCARLAASV*
Ga0182000_1066265323300014487SoilITRERAVLLVLPRDLFEPLFNGDDAVSRGFLDVIQKDLLATLRETLRPCARLAASL*
Ga0157376_1095314523300014969Miscanthus RhizosphereREDAIARVFLDLLLRELVATLGLTLRPHARLAASV*
Ga0134073_1038740023300015356Grasslands SoilVLLLVLARDPFEQLFNRDDAISHVFLDVIQRDMVATLRQTLRPHARLAASL*
Ga0132258_1172960733300015371Arabidopsis RhizosphereLVLPREPFDQLFRREDAISRVFLDVIQRDLVATLRQSLRPHARLAASL*
Ga0132255_10572120913300015374Arabidopsis RhizosphereEDAVSRVFLEAIHRDLLATLRQTLRPCARLTESV*
Ga0190275_1106439313300018432SoilLFARLFAGEDAVSGGFLDVVRNDLMASLRESLRPAARLAASG
Ga0190270_1066393533300018469SoilERSLLLVIPQGLFDQLLQGEDAVSRSFLDVIQKEMIATLRETLRPCARLGASV
Ga0190270_1136328713300018469SoilLFNGEDAVSRGFLDVIQKDLMATLRETLRPCARLAASR
Ga0207642_1065306923300025899Miscanthus RhizosphereVFDQLYRREDAVGRVFVDAIQRDLLVTVRQTLRPYARLASSV
Ga0207688_1059545123300025901Corn, Switchgrass And Miscanthus RhizosphereFDGEDAVSRGFLDVIQKDLMATLRETLRPCARLAARAP
Ga0207685_1058401613300025905Corn, Switchgrass And Miscanthus RhizosphereHGEDAVSRVFLDVIQRELVATLRQTLRPHARLAASL
Ga0207654_1044708113300025911Corn RhizosphereQLFRREDAISRVFLDVIQRDLVATLRQSLRPHARLAASV
Ga0207657_1051197923300025919Corn RhizosphereILLVLPRDVFARLFHSEDAVSRVFLEAIQRDLLATLRQTLRPLARLTASV
Ga0207646_1118788613300025922Corn, Switchgrass And Miscanthus RhizosphereMAEQLFNAEDAVSRVFLDVIQRDLVATLRETSRPNARLSASV
Ga0207687_1178398613300025927Miscanthus RhizosphereTLILSIPRENFTELFHREDTIARVFLDLLLRDLVATLRLTLRPHARLAASV
Ga0207700_1071451023300025928Corn, Switchgrass And Miscanthus RhizospherePRDRFAQLFHGEDAVSRVFLDVIQRELVATLRQTLRPHARLAASL
Ga0207700_1114162213300025928Corn, Switchgrass And Miscanthus RhizosphereFTQLFHGEDAVSRVFLDVIQRELVATLRQTLRPHARLAASL
Ga0207644_1090668913300025931Switchgrass RhizosphereAQLFHGEDAVSRVFLDVIQRELVATLRQTLRPHARLAASL
Ga0207704_1181368213300025938Miscanthus RhizosphereLLVIPHELFGRLFAGEDAVSRGFLDVIQRDLMTALRETLRPRARLAASV
Ga0207665_1083129513300025939Corn, Switchgrass And Miscanthus RhizosphereDRFTQLFHGEDAVSRVFLDVIQRELVATLRQTLRPHARLAASL
Ga0207689_1024405713300025942Miscanthus RhizosphereGVFARLFHSEDAVSRVFLEAIQRDLLAMLRQTLRPYARLTASV
Ga0207661_1198197613300025944Corn RhizosphereGLLLVLPRDPFEQLFNGEDAVSRVFLDVIQRDLVATLRETLRPHARLAASV
Ga0207639_1172665023300026041Corn RhizosphereGEDAVSRGFLDVIQKDLMATLRETLRPCARLAARAP
Ga0207678_1025788323300026067Corn RhizosphereGEDAVSRGFLDVIQRDLMTALRETLRPRARLAASV
Ga0207708_1073980113300026075Corn, Switchgrass And Miscanthus RhizosphereRDVFARLFHSEDAVSRVFLEAIQRDLLATLRQTLRPLARLTASV
Ga0209074_1003638913300027787Agricultural SoilEPFDQLFHREDAISRVFLDVIQRDLVATLRQSLRPHARLAASV
Ga0209254_1070337513300027897Freshwater Lake SedimentTLFTAEDPISRVFLDVIQRDLVATLRQTLSPLARLVASRRA
Ga0247818_1117354213300028589SoilKLFDGEDAVSRGFLDVIQKDLMATLRETLRPCARLAARAP
Ga0247818_1120595923300028589SoilEPLFHREDAVSRVFLDAIQRDLLATLRQTLRPYARLAASV
Ga0247820_1111352813300028597SoilLYRREDAVGRVFVDAIQRDLLVTVRQTLRPYARLASSV
Ga0247819_1087139623300028608SoilVLPRDVFARLFHSEDAVSRVFLEAIQRDLLATLRQTLRPLARLTASV
Ga0247827_1094536513300028889SoilGEDTVSRGFLDVIQKDLMATLRETLRPCARLAASR
Ga0247826_1041273613300030336SoilDLFARLFNGEDAVSRGFLDVIQKDLTTTLRETLRPYARLGASI
Ga0307506_1040996813300031366SoilHFEQLYNGEDAVSRVFLDVIQRDLVATLRETLRPHARLAASV
Ga0318534_1071761713300031544SoilLLILPGNVFDHLFYREDAVSRVFLEAIQRDLLVALRQALRQWARLRASA
Ga0318538_1031735623300031546SoilLFYREDAVSRVFLEAIQRDLLVAVRQALSQWARLRASV
Ga0310887_1025880223300031547SoilLVLPRDLFARLFHSEDAVSRVFLEAIQRDLLATLRQTLRPYARLTASV
Ga0307405_1126804713300031731RhizosphereDHFGQLFHKEDAVARVFLEAIQRDLLASLRQTLRPCARLAASV
Ga0318529_1040061013300031792SoilPFEQLYNRHDTIARLFIEMLLRDLMTTVRSTLRPHARLAASV
Ga0307473_1085617513300031820Hardwood Forest SoilRLFHSEDAVSRVFLEAIQRDLLATLRQALRPYARLTASV
Ga0306925_1032871213300031890SoilLLVVPGNVFDHLFYREDAVSRVFLEAIQRDLLVSLRQALRQWARLRASA
Ga0308176_1207127113300031996SoilFTGEDAVSRVILDVIQADLVATLRQTLRPQARLAASV
Ga0308176_1286677413300031996SoilRACLLVIPHDLFERLFEGEDAVSRGFLDVIQRDLMTALRETLRPRARQAASAPPPTGDR
Ga0307416_10055552523300032002RhizosphereLLLVLQRDVFDQLFHKEDAVSRVFLEAIQRDLLATLRRTLRPCARLAASL
Ga0307416_10076072923300032002RhizosphereVIPRELFEQLFNGEDAVSRGFIDVIQKELVATLRQTLRQHARIAASV
Ga0307416_10258400513300032002RhizosphereFEGEDAVSRGFLDVIQKDLMTALRETLRPRARLAASV
Ga0315275_1207449513300032401SedimentPRGPFEQLFNGEDAVSRVFLDVILRDLVATLRQTLRPHARLAASV
Ga0247830_1019443423300033551SoilHDVFDQLYRREDAVGRVFVDAIQRDLLVTVRQTLRPYARLASSV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.