NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F103657

Metagenome / Metatranscriptome Family F103657

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103657
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 47 residues
Representative Sequence RDDFVVNLAQRYFITPRGHSTPIFETWGLGGLNAGRSETSLRLTYQF
Number of Associated Samples 85
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.98 %
% of genes near scaffold ends (potentially truncated) 96.04 %
% of genes from short scaffolds (< 2000 bps) 92.08 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.040 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(15.842 % of family members)
Environment Ontology (ENVO) Unclassified
(28.713 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.584 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 24.00%    Coil/Unstructured: 76.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF07884VKOR 42.57
PF01381HTH_3 4.95
PF04014MazE_antitoxin 4.95
PF13462Thioredoxin_4 3.96
PF04892VanZ 3.96
PF05721PhyH 2.97
PF12706Lactamase_B_2 2.97
PF13432TPR_16 1.98
PF13483Lactamase_B_3 1.98
PF13414TPR_11 1.98
PF00067p450 0.99
PF02272DHHA1 0.99
PF11941DUF3459 0.99
PF03477ATP-cone 0.99
PF04238DUF420 0.99
PF00590TP_methylase 0.99
PF01925TauE 0.99
PF01642MM_CoA_mutase 0.99
PF07044DUF1329 0.99
PF03280Lipase_chap 0.99
PF14559TPR_19 0.99
PF14579HHH_6 0.99
PF01850PIN 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG4243Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formationGeneral function prediction only [R] 42.57
COG5285Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) familySecondary metabolites biosynthesis, transport and catabolism [Q] 2.97
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.99
COG1884Methylmalonyl-CoA mutase, N-terminal domain/subunitLipid transport and metabolism [I] 0.99
COG2124Cytochrome P450Defense mechanisms [V] 0.99
COG2322Cytochrome oxidase assembly protein CtaM/YozB, DUF420 familyPosttranslational modification, protein turnover, chaperones [O] 0.99
COG5380Lipase chaperone LimKPosttranslational modification, protein turnover, chaperones [O] 0.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.04 %
UnclassifiedrootN/A3.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005171|Ga0066677_10036822All Organisms → cellular organisms → Bacteria → Proteobacteria2380Open in IMG/M
3300005178|Ga0066688_10348006All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300005332|Ga0066388_105337238All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium652Open in IMG/M
3300005363|Ga0008090_15339595All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium512Open in IMG/M
3300005445|Ga0070708_100408018All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1281Open in IMG/M
3300005445|Ga0070708_101434613All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium644Open in IMG/M
3300005446|Ga0066686_10819977All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium617Open in IMG/M
3300005536|Ga0070697_100924435All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium774Open in IMG/M
3300005540|Ga0066697_10655522All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300005545|Ga0070695_100657331All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter828Open in IMG/M
3300005553|Ga0066695_10904813All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300005561|Ga0066699_10878409All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium627Open in IMG/M
3300005719|Ga0068861_100883587All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax845Open in IMG/M
3300005764|Ga0066903_102807175All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium945Open in IMG/M
3300005764|Ga0066903_107361913Not Available569Open in IMG/M
3300005764|Ga0066903_107385176All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300006175|Ga0070712_100745506All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300006796|Ga0066665_10446159All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300006797|Ga0066659_10411477All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1066Open in IMG/M
3300006797|Ga0066659_10652600All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium857Open in IMG/M
3300006844|Ga0075428_100922318All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium926Open in IMG/M
3300006853|Ga0075420_101019515All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium712Open in IMG/M
3300006854|Ga0075425_101825531All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300006854|Ga0075425_102202836All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium614Open in IMG/M
3300006865|Ga0073934_10526509Not Available702Open in IMG/M
3300006871|Ga0075434_101218815All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium764Open in IMG/M
3300006903|Ga0075426_10586296Not Available832Open in IMG/M
3300006904|Ga0075424_102102754All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium595Open in IMG/M
3300007258|Ga0099793_10415038All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium663Open in IMG/M
3300009012|Ga0066710_100211095All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2774Open in IMG/M
3300009012|Ga0066710_101901066All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium891Open in IMG/M
3300009038|Ga0099829_11797726All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300009090|Ga0099827_11930873All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300009094|Ga0111539_13175756All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300009137|Ga0066709_101166208All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1134Open in IMG/M
3300009156|Ga0111538_12962039All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium593Open in IMG/M
3300009162|Ga0075423_10183495All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2196Open in IMG/M
3300009162|Ga0075423_10569265All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1193Open in IMG/M
3300009162|Ga0075423_11428300All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium741Open in IMG/M
3300010047|Ga0126382_12292249All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium522Open in IMG/M
3300010047|Ga0126382_12494867All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300010303|Ga0134082_10249594All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300010320|Ga0134109_10043559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1468Open in IMG/M
3300010326|Ga0134065_10124364All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium879Open in IMG/M
3300010398|Ga0126383_12939728All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300010399|Ga0134127_10146505All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2138Open in IMG/M
3300010401|Ga0134121_10913592All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium854Open in IMG/M
3300012189|Ga0137388_11868554All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300012207|Ga0137381_10210049All Organisms → cellular organisms → Bacteria1688Open in IMG/M
3300012285|Ga0137370_10906653All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium545Open in IMG/M
3300012357|Ga0137384_10081143All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2696Open in IMG/M
3300012363|Ga0137390_10188770All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2048Open in IMG/M
3300012685|Ga0137397_11115969All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300012927|Ga0137416_10822668All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium822Open in IMG/M
3300012929|Ga0137404_10065851All Organisms → cellular organisms → Bacteria2827Open in IMG/M
3300012944|Ga0137410_12097562All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300013306|Ga0163162_12338640All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium614Open in IMG/M
3300015241|Ga0137418_10724414All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium758Open in IMG/M
3300015356|Ga0134073_10298471All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300015358|Ga0134089_10087258All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1182Open in IMG/M
3300015358|Ga0134089_10304764All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium662Open in IMG/M
3300015358|Ga0134089_10554144All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium510Open in IMG/M
3300016422|Ga0182039_10520826All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1029Open in IMG/M
3300017659|Ga0134083_10556912All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300018433|Ga0066667_10221251All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1410Open in IMG/M
3300018433|Ga0066667_11149471All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium673Open in IMG/M
3300018468|Ga0066662_10341350All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1283Open in IMG/M
3300018468|Ga0066662_11606224All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium678Open in IMG/M
3300018482|Ga0066669_10042231All Organisms → cellular organisms → Bacteria2809Open in IMG/M
3300018482|Ga0066669_10925729All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300020170|Ga0179594_10315398All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium593Open in IMG/M
3300022213|Ga0224500_10268181All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium621Open in IMG/M
3300025915|Ga0207693_10658832All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300026075|Ga0207708_11171043All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium672Open in IMG/M
3300026089|Ga0207648_11330901All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium675Open in IMG/M
3300026118|Ga0207675_102526466All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300026118|Ga0207675_102611961All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300026324|Ga0209470_1354200All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium526Open in IMG/M
3300026329|Ga0209375_1058351All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1885Open in IMG/M
3300026330|Ga0209473_1291111All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300026342|Ga0209057_1195526All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300027840|Ga0209683_10543049All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300027909|Ga0209382_10777015All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1022Open in IMG/M
3300028381|Ga0268264_12654533All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
3300028536|Ga0137415_10501510All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1022Open in IMG/M
3300028536|Ga0137415_10975053All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium659Open in IMG/M
3300031368|Ga0307429_1119728All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300031474|Ga0170818_104312205Not Available1122Open in IMG/M
3300031572|Ga0318515_10696152All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium538Open in IMG/M
3300031793|Ga0318548_10595471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300031795|Ga0318557_10435144All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium603Open in IMG/M
3300031854|Ga0310904_11246257All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M
3300031858|Ga0310892_10383560All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium911Open in IMG/M
3300031949|Ga0214473_11458974All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium693Open in IMG/M
3300032089|Ga0318525_10680983All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M
3300032144|Ga0315910_10997653All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium653Open in IMG/M
3300032180|Ga0307471_102319026All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium677Open in IMG/M
3300032205|Ga0307472_101779171All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium611Open in IMG/M
3300032275|Ga0315270_10843422All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium604Open in IMG/M
3300032397|Ga0315287_11201257All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium873Open in IMG/M
3300032829|Ga0335070_10469549All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1195Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.84%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere12.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil8.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil7.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.97%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.98%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.98%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.99%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.99%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.99%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.99%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.99%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300022213Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031368Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-230EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066677_1003682213300005171SoilDYVVRDDFVVNLAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF*
Ga0066688_1034800613300005178SoilYVVRDDFVVNLAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF*
Ga0066388_10533723823300005332Tropical Forest SoilYVIRDDLVVNLGQRYFFVPRGDTLNHPVFETWGLGGLNKGRSETSLRVTYQF*
Ga0008090_1533959513300005363Tropical Rainforest SoilDYVVRDDFVVNLAQRYFIEPRGHSTPIFETWGLGGLNAGRSETSLRLTYQF*
Ga0070708_10040801823300005445Corn, Switchgrass And Miscanthus RhizosphereRDDFVVNLSQRYVVTPRGHSTPIFSTWGLGSLNSGRSETDIRLTYQF*
Ga0070708_10143461323300005445Corn, Switchgrass And Miscanthus RhizosphereVVNVGQHYFVTPRGHSSPIFETWGLAGLNTGRSETTIRLTFQF*
Ga0066686_1081997723300005446SoilVNLAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF*
Ga0070697_10092443523300005536Corn, Switchgrass And Miscanthus RhizosphereVDYVVRDDFVVNLGQHYFVAPRGHSTPIFETWGLAGLNAGRSETTLRLTYQF*
Ga0066697_1065552213300005540SoilQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF*
Ga0070695_10065733113300005545Corn, Switchgrass And Miscanthus RhizospherePFWMVDYVVRDDFVVNLSQRYMVTPRGHSTPIFETWGLSGLNAGRSETDIRLTYQF*
Ga0066695_1090481313300005553SoilRYFVTPRGHHDPIFQTWGLGSLAQGRSETSLRLTYQF*
Ga0066699_1087840913300005561SoilFVVNIAQRYFVAPRGHSTPIFETWGLGGLNAGRSETSLRLTYQF*
Ga0068861_10088358713300005719Switchgrass RhizosphereNLSQRYIVTPRGHSTPIFSTWGLGSLNSGRSETNIRITYQF*
Ga0066903_10280717513300005764Tropical Forest SoilWNMEPFWSVDYVIRDDFVVNLGQRYFFVPRGDTLNHPVFETWGLAGLNKGRSETSLRITYQF*
Ga0066903_10736191313300005764Tropical Forest SoilDYVVRDDFVVNLAQRYFIEPTGHSTPIFETWGLGGLNADRSETSLRLTYQF*
Ga0066903_10738517613300005764Tropical Forest SoilRYFIEPRGHSTPIFETWGIGGLNADRSETALRLTYQF*
Ga0070712_10074550623300006175Corn, Switchgrass And Miscanthus RhizosphereINLAQRYFVTPRGQSTPIFSPWGFGAASRDRSETELRLTYQF*
Ga0066665_1044615943300006796SoilNLAQRYFITPRGHSTPIFESWGLGGLLTGRSETSLRLTYQF*
Ga0066659_1041147733300006797SoilLVVNLAQRYFITPRGHSTPIFESWGLGGLLAGRSETSLRLTYQF*
Ga0066659_1065260023300006797SoilYVVRDDFVVNVAQRYFVTPKGRSTPIFETWGLGCFNNSRSETELVLTYQF*
Ga0075428_10092231823300006844Populus RhizosphereDDFVINLSQRYIVTPRGHSTPIFSTWGLGSLNSGRSETNIRLTYQF*
Ga0075420_10101951513300006853Populus RhizosphereLSQRHIVTPHGHATPIFSTWGLGGLSSGRSETNLRITYQF*
Ga0075425_10182553123300006854Populus RhizosphereLDYVVRDDMIVNVTQRYFVNPRGTSQPNFSPWGFGNLGRGRSESELRLTYQF*
Ga0075425_10220283613300006854Populus RhizosphereYFVTPRGHSTPIFETWGLAGLNAGRSETTIRLTYQF*
Ga0073934_1052650913300006865Hot Spring SedimentQRYMVTPRGHSTPIFETWGLAGLNAGRSETNIRLTYQF*
Ga0075434_10121881513300006871Populus RhizosphereVDYVIRDDLLINLAQRYFVTPRGQSDPVYSPWGFGSFARDRSETELRLTYQF*
Ga0075426_1058629613300006903Populus RhizosphereVDYVIRDDFLINLAQRYFVTPRGQSTPVYSPWGFGSIARDRSETELRLTYQF*
Ga0075424_10210275423300006904Populus RhizosphereDFVINVGQHYFVNPRGKKELFSSWGLAGLNSGRSETSIRLTYQF*
Ga0099793_1041503813300007258Vadose Zone SoilDYVLRDDVVVNLAQRYFVTPRGRSTPIFETWGLAGLNSGRSETSLRLTFQF*
Ga0066710_10021109543300009012Grasslands SoilLVVNLAQRYFITPRGHSTPIFESWGLGGLLAGRSETSLRLTYQF
Ga0066710_10190106613300009012Grasslands SoilVVNVAQRYFVAPRGHSAPIFETWGLGGLNQGRSETSLRLTYQF
Ga0099829_1179772623300009038Vadose Zone SoilVVNLAQRYFVTPRGHHTPIFETWGLAGLNAGRSETSLRLTFQF*
Ga0099827_1193087313300009090Vadose Zone SoilAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF*
Ga0111539_1317575623300009094Populus RhizosphereNLSQRYIVTPRGHHDPIYSTWGLGSLNSGRSETNIRLTYQF*
Ga0066709_10116620813300009137Grasslands SoilLAQRYFITPRGHSTPIFESWGLGGLLAGRSETSLRLTYQF*
Ga0111538_1296203923300009156Populus RhizosphereLPFWMVDYVVRDDFVINLSQRYIVTPKGHSTPIFSTWGLGSLNSGRSETDIRITYQF*
Ga0075423_1018349513300009162Populus RhizosphereDYVFRDDLVLNLGQRYFVNPRGKDQLFSAWGLAGLNSGRSETSIRLTYQF*
Ga0075423_1056926523300009162Populus RhizosphereRYFVNPRGKDQLFSAWGLAGLNSGRSETSIRLTYQF*
Ga0075423_1142830013300009162Populus RhizosphereNLAQRYFVTPRGHSTPIFETWGLAGLNTGRSETSLRLTFQF*
Ga0126382_1229224923300010047Tropical Forest SoilDDLVVNLGQRYFFVPRGDTLNHPVFETWGLGGLNKGRSETSLRVTYQF*
Ga0126382_1249486723300010047Tropical Forest SoilYFIEPRGHSTPIFETWGLAGLNADRSETSLRLTFQF*
Ga0134082_1024959413300010303Grasslands SoilYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF*
Ga0134109_1004355943300010320Grasslands SoilVDYVVRDDFVVNLAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF*
Ga0134065_1012436423300010326Grasslands SoilDYVVRDDFVVNLAQRYFVTPMGHSTPIFETWGLAGINGDRSETELRLTYQF*
Ga0126383_1293972813300010398Tropical Forest SoilLAQRYMVTPKGHSTPIFETFGLAGLNFGRSETELRLTYQF*
Ga0134127_1014650513300010399Terrestrial SoilGHDHAPFWTLDYVMRDDLVLNIAQRYFVTPRGHHTPIFETWGLAGLNSGRSETSLRVTYQF*
Ga0134121_1091359223300010401Terrestrial SoilDYVLRDDLVVNLAQRYFITPRGHSEPIFETWGLAGLNAGRSETSLRLTYQY*
Ga0137388_1186855423300012189Vadose Zone SoilVVNLAQRYFVTPRGRETPIFETWGLAGLNSGRSETSLRLTFQF*
Ga0137381_1021004933300012207Vadose Zone SoilVVNLAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF*
Ga0137370_1090665323300012285Vadose Zone SoilFVVNVAQRYFVTPKGRSTPIFETWGLGGLNNSRSETELVLTYQF*
Ga0137384_1008114313300012357Vadose Zone SoilVRDDFVVNIAQRYFVTPMGHSTPIFETWGLAGINGDRSETELRLTYQF*
Ga0137390_1018877043300012363Vadose Zone SoilVVRDDFVVNLGQRYFVTPRGHSTPIFDTWGLGGLNNSRSETELRLTYQF*
Ga0137397_1111596913300012685Vadose Zone SoilINLAQRYFVTPRGHSEPIFQTWAPGGITAGRSETSLRLTYQF*
Ga0137416_1082266823300012927Vadose Zone SoilYVVRDDFVVNLAQRYFVTPRGRSTPIFETWGLAGLNSGRSETSLRLTFQF*
Ga0137404_1006585113300012929Vadose Zone SoilQRYFVTPMGHSTPIFESWGLGGLNNSRSETELVLTYQF*
Ga0137410_1209756223300012944Vadose Zone SoilFWDVDYVLRDDLVVNLGQRYFVTPRGEHTPVFSPWGFGALSSGRSETSLRLTFQF*
Ga0163162_1233864013300013306Switchgrass RhizosphereEPFWDVDYIVRNDLVVNIGQRYFVTPRGHNTPIFETWGLAGLNQGRSETTIRLTYQW*
Ga0137418_1072441423300015241Vadose Zone SoilVVNLAQRYFVTPRGRSTPIFETWGLAGLNSGRSETSLRLTFQF*
Ga0134073_1029847123300015356Grasslands SoilWSMEPFWTVTYVVRDDFVLNVAQRYFVTPKGRSTPIFESWGLGGLNNSRSETELVLTYQF
Ga0134089_1008725813300015358Grasslands SoilIAQRYFVTPMGHSQPIFETWGLAGINGGRSETELRLTYQF*
Ga0134089_1030476413300015358Grasslands SoilMEPFWTVSYVVRDDFVVNVAQRYFVTPKGHSTPIFETWGLGGFNHGRSETELVLTYQF*
Ga0134089_1055414423300015358Grasslands SoilDYVVRDDFVVNLAQRYFVTPRGRETPIFETWGLAGLNSGRSETSLRLTFQF*
Ga0182039_1052082613300016422SoilDLIVNLAQRYFIEPRGHSTPIFETWGLGGLNEGRSETSLRLTYQF
Ga0134083_1055691213300017659Grasslands SoilTIRDDLVVNLTQRYFITPYGQSEPIFDPWGFSSMSAGRSETSLRFTYQF
Ga0066667_1022125113300018433Grasslands SoilNVAQRYFVTPKGRSTPIFESWGLGGLNNSRSETELVLTYQF
Ga0066667_1114947123300018433Grasslands SoilVVRDDLVVNLAQRYMVTPRGHHNPIFETWGLAGLNAGRSETSVRLTLQF
Ga0066662_1034135023300018468Grasslands SoilVVNLAQRYFVTPRGRSTPIFETWGLAGLNSGRSETSLRLTFQF
Ga0066662_1160622423300018468Grasslands SoilVVRDYFVVNIAQRYFVTPMGHSTPIFESWGLAGINSGRSETEVRLTYQF
Ga0066669_1004223113300018482Grasslands SoilVVNLAQRYFVTPRGRETPIFETWGLAGLNSGRSETSLRLTFQF
Ga0066669_1092572933300018482Grasslands SoilVNLAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF
Ga0179594_1031539823300020170Vadose Zone SoilFVVNLAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF
Ga0224500_1026818123300022213SedimentKDWLVFNLSQRYFVTPRGYGEPIYETWGIAGLNRGRSETVLRATFQF
Ga0207693_1065883223300025915Corn, Switchgrass And Miscanthus RhizosphereYVLRDDLLINLAQRYFVTPRGQSTPIFSPWGFGAASRDRSETELRLTYQF
Ga0207708_1117104313300026075Corn, Switchgrass And Miscanthus RhizosphereNDFVFNIGQRFFVTPNGHSEPIFETWGLAGFNAGRSETTIRLTYQF
Ga0207648_1133090113300026089Miscanthus RhizosphereEIGNDLVVNIGQRYFVTPRGHHTPIFETWGLAGLNQGRSETTIRLTYQW
Ga0207675_10252646623300026118Switchgrass RhizosphereVNLSQRYMVTPRGHSTPIFETWGLGGLNAGRSETDIRLTWQF
Ga0207675_10261196113300026118Switchgrass RhizosphereFWMVDYVVRDDFVINLSQRYIVTPRGHSTPIFSTWGLGSLNSGRSETDIRLTYQF
Ga0209470_135420013300026324SoilQRYFVTPMGHSTPIFETWGLAGINGDRSETELRLTYQF
Ga0209375_105835113300026329SoilAVDYVVRDDFVVNLAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF
Ga0209473_129111123300026330SoilLDYVVRDDFVVNLAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF
Ga0209057_119552623300026342SoilVDYVVRDDLVVNLAQRYFVTPRGHHDPIFQTWGLGSLAQGRSETSLRLTYQF
Ga0209683_1054304923300027840Wetland SedimentNLGQRYYIQPHGHTTPIFETWGVAGLNAGRSETTLRVTYQF
Ga0209382_1077701523300027909Populus RhizosphereMVDYVVRDDFVINLSQRYIVTPRGHSTPIFSTWGLGSLNSGRSETNIRLTYQF
Ga0268264_1265453313300028381Switchgrass RhizosphereNQFAMEAFCDVDYVLRDDLVVNLGQRYFISPRGNSTPIFSPWGFGALSAGRSETSLRLTFQF
Ga0137415_1050151023300028536Vadose Zone SoilRDDFVVNLAQRYFVTPRGRSTPIFETWGLAGLNSGRSETSLRLTFQF
Ga0137415_1097505323300028536Vadose Zone SoilDYVLRDDFVINLAQRYFVNPRGKNQLYSAWGLAGLNSGRSETSIRLTYQF
Ga0307429_111972813300031368Salt MarshFITPRGQSEPIFATWGLPSLSGRRSETSLRLTYQF
Ga0170818_10431220533300031474Forest SoilDDFVVNLAQRYFIEPRGHSSPIFETWGLGGLNADRSETSLRLTYQF
Ga0318515_1069615213300031572SoilDLIVNLAQRYFIEPRGHSTPIFETWGLGGLNAGRSETSLRLTYQF
Ga0318548_1059547113300031793SoilRYFITPRGHSTPIFETWGLGSLGAGRSETGLRLTYQF
Ga0318557_1043514413300031795SoilVVRDDFVVNLAQRYFIEPRGRSTPIFETWGLGGLNAGRSETSLRLTYQF
Ga0310904_1124625713300031854SoilVLPFWMVDYVVRDDFVINLSQRYIVTPRGQSTPIFSTWGIGSLNSGRSETNIRLTYQF
Ga0310892_1038356013300031858SoilDDFVVNLSQRYFITPRGHSEPIFETWGLAGLNAGRSETALRLTYQY
Ga0214473_1145897413300031949SoilTPSVGFTLSQHYFVTPKGHSEPIFETWGLSGLNAGRSETTVRLTYQF
Ga0318525_1068098313300032089SoilRDDFVVNLAQRYFITPRGHSTPIFETWGLGGLNAGRSETSLRLTYQF
Ga0315910_1099765313300032144SoilVNLAQRYFVTPRGHHEPSFETWGLAGLNAGRSETSLRLTYQY
Ga0307471_10231902613300032180Hardwood Forest SoilQFAMLPFWDLDYVLRDDFVVNVGQRYFVNPRGKEQLFSSWGLAGLNSGRSETSIRLTYQF
Ga0307472_10177917133300032205Hardwood Forest SoilVNLGQRYFVTPRGQSSPIFSPWGFGSLTGGRSETSLRLTYQF
Ga0315270_1084342213300032275SedimentMEPFWTVDYVVRNDLVVNIGQRYFVTPRGNSTPIFETWGLADLNQGRSETSIRLTYQF
Ga0315287_1120125723300032397SedimentVVNVGQRYFVTPRGHSDPIFETWGLGGLNAGRTETTIRLTYQF
Ga0335070_1046954923300032829SoilMVVNVGQRYFVAPRGRSTPIFETWGLGGLSAGRSETTLRLTYQF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.