Basic Information | |
---|---|
Family ID | F103657 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 101 |
Average Sequence Length | 47 residues |
Representative Sequence | RDDFVVNLAQRYFITPRGHSTPIFETWGLGGLNAGRSETSLRLTYQF |
Number of Associated Samples | 85 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.98 % |
% of genes near scaffold ends (potentially truncated) | 96.04 % |
% of genes from short scaffolds (< 2000 bps) | 92.08 % |
Associated GOLD sequencing projects | 81 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.23 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.040 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.842 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.713 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.584 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 24.00% Coil/Unstructured: 76.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF07884 | VKOR | 42.57 |
PF01381 | HTH_3 | 4.95 |
PF04014 | MazE_antitoxin | 4.95 |
PF13462 | Thioredoxin_4 | 3.96 |
PF04892 | VanZ | 3.96 |
PF05721 | PhyH | 2.97 |
PF12706 | Lactamase_B_2 | 2.97 |
PF13432 | TPR_16 | 1.98 |
PF13483 | Lactamase_B_3 | 1.98 |
PF13414 | TPR_11 | 1.98 |
PF00067 | p450 | 0.99 |
PF02272 | DHHA1 | 0.99 |
PF11941 | DUF3459 | 0.99 |
PF03477 | ATP-cone | 0.99 |
PF04238 | DUF420 | 0.99 |
PF00590 | TP_methylase | 0.99 |
PF01925 | TauE | 0.99 |
PF01642 | MM_CoA_mutase | 0.99 |
PF07044 | DUF1329 | 0.99 |
PF03280 | Lipase_chap | 0.99 |
PF14559 | TPR_19 | 0.99 |
PF14579 | HHH_6 | 0.99 |
PF01850 | PIN | 0.99 |
COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
---|---|---|---|
COG4243 | Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formation | General function prediction only [R] | 42.57 |
COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.97 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.99 |
COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.99 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.99 |
COG2322 | Cytochrome oxidase assembly protein CtaM/YozB, DUF420 family | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
COG5380 | Lipase chaperone LimK | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.04 % |
Unclassified | root | N/A | 3.96 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005171|Ga0066677_10036822 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2380 | Open in IMG/M |
3300005178|Ga0066688_10348006 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300005332|Ga0066388_105337238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 652 | Open in IMG/M |
3300005363|Ga0008090_15339595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 512 | Open in IMG/M |
3300005445|Ga0070708_100408018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1281 | Open in IMG/M |
3300005445|Ga0070708_101434613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 644 | Open in IMG/M |
3300005446|Ga0066686_10819977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 617 | Open in IMG/M |
3300005536|Ga0070697_100924435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 774 | Open in IMG/M |
3300005540|Ga0066697_10655522 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300005545|Ga0070695_100657331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 828 | Open in IMG/M |
3300005553|Ga0066695_10904813 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300005561|Ga0066699_10878409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 627 | Open in IMG/M |
3300005719|Ga0068861_100883587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 845 | Open in IMG/M |
3300005764|Ga0066903_102807175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 945 | Open in IMG/M |
3300005764|Ga0066903_107361913 | Not Available | 569 | Open in IMG/M |
3300005764|Ga0066903_107385176 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300006175|Ga0070712_100745506 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300006796|Ga0066665_10446159 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300006797|Ga0066659_10411477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1066 | Open in IMG/M |
3300006797|Ga0066659_10652600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 857 | Open in IMG/M |
3300006844|Ga0075428_100922318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 926 | Open in IMG/M |
3300006853|Ga0075420_101019515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 712 | Open in IMG/M |
3300006854|Ga0075425_101825531 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300006854|Ga0075425_102202836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 614 | Open in IMG/M |
3300006865|Ga0073934_10526509 | Not Available | 702 | Open in IMG/M |
3300006871|Ga0075434_101218815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 764 | Open in IMG/M |
3300006903|Ga0075426_10586296 | Not Available | 832 | Open in IMG/M |
3300006904|Ga0075424_102102754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 595 | Open in IMG/M |
3300007258|Ga0099793_10415038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 663 | Open in IMG/M |
3300009012|Ga0066710_100211095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2774 | Open in IMG/M |
3300009012|Ga0066710_101901066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 891 | Open in IMG/M |
3300009038|Ga0099829_11797726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
3300009090|Ga0099827_11930873 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300009094|Ga0111539_13175756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 530 | Open in IMG/M |
3300009137|Ga0066709_101166208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1134 | Open in IMG/M |
3300009156|Ga0111538_12962039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 593 | Open in IMG/M |
3300009162|Ga0075423_10183495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2196 | Open in IMG/M |
3300009162|Ga0075423_10569265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1193 | Open in IMG/M |
3300009162|Ga0075423_11428300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 741 | Open in IMG/M |
3300010047|Ga0126382_12292249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
3300010047|Ga0126382_12494867 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300010303|Ga0134082_10249594 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300010320|Ga0134109_10043559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1468 | Open in IMG/M |
3300010326|Ga0134065_10124364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 879 | Open in IMG/M |
3300010398|Ga0126383_12939728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
3300010399|Ga0134127_10146505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2138 | Open in IMG/M |
3300010401|Ga0134121_10913592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 854 | Open in IMG/M |
3300012189|Ga0137388_11868554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
3300012207|Ga0137381_10210049 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
3300012285|Ga0137370_10906653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 545 | Open in IMG/M |
3300012357|Ga0137384_10081143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2696 | Open in IMG/M |
3300012363|Ga0137390_10188770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2048 | Open in IMG/M |
3300012685|Ga0137397_11115969 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300012927|Ga0137416_10822668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 822 | Open in IMG/M |
3300012929|Ga0137404_10065851 | All Organisms → cellular organisms → Bacteria | 2827 | Open in IMG/M |
3300012944|Ga0137410_12097562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
3300013306|Ga0163162_12338640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 614 | Open in IMG/M |
3300015241|Ga0137418_10724414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 758 | Open in IMG/M |
3300015356|Ga0134073_10298471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 574 | Open in IMG/M |
3300015358|Ga0134089_10087258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1182 | Open in IMG/M |
3300015358|Ga0134089_10304764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 662 | Open in IMG/M |
3300015358|Ga0134089_10554144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 510 | Open in IMG/M |
3300016422|Ga0182039_10520826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1029 | Open in IMG/M |
3300017659|Ga0134083_10556912 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300018433|Ga0066667_10221251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1410 | Open in IMG/M |
3300018433|Ga0066667_11149471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 673 | Open in IMG/M |
3300018468|Ga0066662_10341350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1283 | Open in IMG/M |
3300018468|Ga0066662_11606224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 678 | Open in IMG/M |
3300018482|Ga0066669_10042231 | All Organisms → cellular organisms → Bacteria | 2809 | Open in IMG/M |
3300018482|Ga0066669_10925729 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300020170|Ga0179594_10315398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 593 | Open in IMG/M |
3300022213|Ga0224500_10268181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 621 | Open in IMG/M |
3300025915|Ga0207693_10658832 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300026075|Ga0207708_11171043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 672 | Open in IMG/M |
3300026089|Ga0207648_11330901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 675 | Open in IMG/M |
3300026118|Ga0207675_102526466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
3300026118|Ga0207675_102611961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
3300026324|Ga0209470_1354200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 526 | Open in IMG/M |
3300026329|Ga0209375_1058351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1885 | Open in IMG/M |
3300026330|Ga0209473_1291111 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300026342|Ga0209057_1195526 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300027840|Ga0209683_10543049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 530 | Open in IMG/M |
3300027909|Ga0209382_10777015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1022 | Open in IMG/M |
3300028381|Ga0268264_12654533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
3300028536|Ga0137415_10501510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1022 | Open in IMG/M |
3300028536|Ga0137415_10975053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 659 | Open in IMG/M |
3300031368|Ga0307429_1119728 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300031474|Ga0170818_104312205 | Not Available | 1122 | Open in IMG/M |
3300031572|Ga0318515_10696152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 538 | Open in IMG/M |
3300031793|Ga0318548_10595471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
3300031795|Ga0318557_10435144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 603 | Open in IMG/M |
3300031854|Ga0310904_11246257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 537 | Open in IMG/M |
3300031858|Ga0310892_10383560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 911 | Open in IMG/M |
3300031949|Ga0214473_11458974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 693 | Open in IMG/M |
3300032089|Ga0318525_10680983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
3300032144|Ga0315910_10997653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 653 | Open in IMG/M |
3300032180|Ga0307471_102319026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 677 | Open in IMG/M |
3300032205|Ga0307472_101779171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 611 | Open in IMG/M |
3300032275|Ga0315270_10843422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 604 | Open in IMG/M |
3300032397|Ga0315287_11201257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 873 | Open in IMG/M |
3300032829|Ga0335070_10469549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1195 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.84% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.88% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.92% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.97% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.98% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.98% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.98% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.99% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.99% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.99% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.99% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.99% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.99% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.99% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031368 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-230 | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0066677_100368221 | 3300005171 | Soil | DYVVRDDFVVNLAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF* |
Ga0066688_103480061 | 3300005178 | Soil | YVVRDDFVVNLAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF* |
Ga0066388_1053372382 | 3300005332 | Tropical Forest Soil | YVIRDDLVVNLGQRYFFVPRGDTLNHPVFETWGLGGLNKGRSETSLRVTYQF* |
Ga0008090_153395951 | 3300005363 | Tropical Rainforest Soil | DYVVRDDFVVNLAQRYFIEPRGHSTPIFETWGLGGLNAGRSETSLRLTYQF* |
Ga0070708_1004080182 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RDDFVVNLSQRYVVTPRGHSTPIFSTWGLGSLNSGRSETDIRLTYQF* |
Ga0070708_1014346132 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VVNVGQHYFVTPRGHSSPIFETWGLAGLNTGRSETTIRLTFQF* |
Ga0066686_108199772 | 3300005446 | Soil | VNLAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF* |
Ga0070697_1009244352 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VDYVVRDDFVVNLGQHYFVAPRGHSTPIFETWGLAGLNAGRSETTLRLTYQF* |
Ga0066697_106555221 | 3300005540 | Soil | QRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF* |
Ga0070695_1006573311 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | PFWMVDYVVRDDFVVNLSQRYMVTPRGHSTPIFETWGLSGLNAGRSETDIRLTYQF* |
Ga0066695_109048131 | 3300005553 | Soil | RYFVTPRGHHDPIFQTWGLGSLAQGRSETSLRLTYQF* |
Ga0066699_108784091 | 3300005561 | Soil | FVVNIAQRYFVAPRGHSTPIFETWGLGGLNAGRSETSLRLTYQF* |
Ga0068861_1008835871 | 3300005719 | Switchgrass Rhizosphere | NLSQRYIVTPRGHSTPIFSTWGLGSLNSGRSETNIRITYQF* |
Ga0066903_1028071751 | 3300005764 | Tropical Forest Soil | WNMEPFWSVDYVIRDDFVVNLGQRYFFVPRGDTLNHPVFETWGLAGLNKGRSETSLRITYQF* |
Ga0066903_1073619131 | 3300005764 | Tropical Forest Soil | DYVVRDDFVVNLAQRYFIEPTGHSTPIFETWGLGGLNADRSETSLRLTYQF* |
Ga0066903_1073851761 | 3300005764 | Tropical Forest Soil | RYFIEPRGHSTPIFETWGIGGLNADRSETALRLTYQF* |
Ga0070712_1007455062 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | INLAQRYFVTPRGQSTPIFSPWGFGAASRDRSETELRLTYQF* |
Ga0066665_104461594 | 3300006796 | Soil | NLAQRYFITPRGHSTPIFESWGLGGLLTGRSETSLRLTYQF* |
Ga0066659_104114773 | 3300006797 | Soil | LVVNLAQRYFITPRGHSTPIFESWGLGGLLAGRSETSLRLTYQF* |
Ga0066659_106526002 | 3300006797 | Soil | YVVRDDFVVNVAQRYFVTPKGRSTPIFETWGLGCFNNSRSETELVLTYQF* |
Ga0075428_1009223182 | 3300006844 | Populus Rhizosphere | DDFVINLSQRYIVTPRGHSTPIFSTWGLGSLNSGRSETNIRLTYQF* |
Ga0075420_1010195151 | 3300006853 | Populus Rhizosphere | LSQRHIVTPHGHATPIFSTWGLGGLSSGRSETNLRITYQF* |
Ga0075425_1018255312 | 3300006854 | Populus Rhizosphere | LDYVVRDDMIVNVTQRYFVNPRGTSQPNFSPWGFGNLGRGRSESELRLTYQF* |
Ga0075425_1022028361 | 3300006854 | Populus Rhizosphere | YFVTPRGHSTPIFETWGLAGLNAGRSETTIRLTYQF* |
Ga0073934_105265091 | 3300006865 | Hot Spring Sediment | QRYMVTPRGHSTPIFETWGLAGLNAGRSETNIRLTYQF* |
Ga0075434_1012188151 | 3300006871 | Populus Rhizosphere | VDYVIRDDLLINLAQRYFVTPRGQSDPVYSPWGFGSFARDRSETELRLTYQF* |
Ga0075426_105862961 | 3300006903 | Populus Rhizosphere | VDYVIRDDFLINLAQRYFVTPRGQSTPVYSPWGFGSIARDRSETELRLTYQF* |
Ga0075424_1021027542 | 3300006904 | Populus Rhizosphere | DFVINVGQHYFVNPRGKKELFSSWGLAGLNSGRSETSIRLTYQF* |
Ga0099793_104150381 | 3300007258 | Vadose Zone Soil | DYVLRDDVVVNLAQRYFVTPRGRSTPIFETWGLAGLNSGRSETSLRLTFQF* |
Ga0066710_1002110954 | 3300009012 | Grasslands Soil | LVVNLAQRYFITPRGHSTPIFESWGLGGLLAGRSETSLRLTYQF |
Ga0066710_1019010661 | 3300009012 | Grasslands Soil | VVNVAQRYFVAPRGHSAPIFETWGLGGLNQGRSETSLRLTYQF |
Ga0099829_117977262 | 3300009038 | Vadose Zone Soil | VVNLAQRYFVTPRGHHTPIFETWGLAGLNAGRSETSLRLTFQF* |
Ga0099827_119308731 | 3300009090 | Vadose Zone Soil | AQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF* |
Ga0111539_131757562 | 3300009094 | Populus Rhizosphere | NLSQRYIVTPRGHHDPIYSTWGLGSLNSGRSETNIRLTYQF* |
Ga0066709_1011662081 | 3300009137 | Grasslands Soil | LAQRYFITPRGHSTPIFESWGLGGLLAGRSETSLRLTYQF* |
Ga0111538_129620392 | 3300009156 | Populus Rhizosphere | LPFWMVDYVVRDDFVINLSQRYIVTPKGHSTPIFSTWGLGSLNSGRSETDIRITYQF* |
Ga0075423_101834951 | 3300009162 | Populus Rhizosphere | DYVFRDDLVLNLGQRYFVNPRGKDQLFSAWGLAGLNSGRSETSIRLTYQF* |
Ga0075423_105692652 | 3300009162 | Populus Rhizosphere | RYFVNPRGKDQLFSAWGLAGLNSGRSETSIRLTYQF* |
Ga0075423_114283001 | 3300009162 | Populus Rhizosphere | NLAQRYFVTPRGHSTPIFETWGLAGLNTGRSETSLRLTFQF* |
Ga0126382_122922492 | 3300010047 | Tropical Forest Soil | DDLVVNLGQRYFFVPRGDTLNHPVFETWGLGGLNKGRSETSLRVTYQF* |
Ga0126382_124948672 | 3300010047 | Tropical Forest Soil | YFIEPRGHSTPIFETWGLAGLNADRSETSLRLTFQF* |
Ga0134082_102495941 | 3300010303 | Grasslands Soil | YFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF* |
Ga0134109_100435594 | 3300010320 | Grasslands Soil | VDYVVRDDFVVNLAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF* |
Ga0134065_101243642 | 3300010326 | Grasslands Soil | DYVVRDDFVVNLAQRYFVTPMGHSTPIFETWGLAGINGDRSETELRLTYQF* |
Ga0126383_129397281 | 3300010398 | Tropical Forest Soil | LAQRYMVTPKGHSTPIFETFGLAGLNFGRSETELRLTYQF* |
Ga0134127_101465051 | 3300010399 | Terrestrial Soil | GHDHAPFWTLDYVMRDDLVLNIAQRYFVTPRGHHTPIFETWGLAGLNSGRSETSLRVTYQF* |
Ga0134121_109135922 | 3300010401 | Terrestrial Soil | DYVLRDDLVVNLAQRYFITPRGHSEPIFETWGLAGLNAGRSETSLRLTYQY* |
Ga0137388_118685542 | 3300012189 | Vadose Zone Soil | VVNLAQRYFVTPRGRETPIFETWGLAGLNSGRSETSLRLTFQF* |
Ga0137381_102100493 | 3300012207 | Vadose Zone Soil | VVNLAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF* |
Ga0137370_109066532 | 3300012285 | Vadose Zone Soil | FVVNVAQRYFVTPKGRSTPIFETWGLGGLNNSRSETELVLTYQF* |
Ga0137384_100811431 | 3300012357 | Vadose Zone Soil | VRDDFVVNIAQRYFVTPMGHSTPIFETWGLAGINGDRSETELRLTYQF* |
Ga0137390_101887704 | 3300012363 | Vadose Zone Soil | VVRDDFVVNLGQRYFVTPRGHSTPIFDTWGLGGLNNSRSETELRLTYQF* |
Ga0137397_111159691 | 3300012685 | Vadose Zone Soil | INLAQRYFVTPRGHSEPIFQTWAPGGITAGRSETSLRLTYQF* |
Ga0137416_108226682 | 3300012927 | Vadose Zone Soil | YVVRDDFVVNLAQRYFVTPRGRSTPIFETWGLAGLNSGRSETSLRLTFQF* |
Ga0137404_100658511 | 3300012929 | Vadose Zone Soil | QRYFVTPMGHSTPIFESWGLGGLNNSRSETELVLTYQF* |
Ga0137410_120975622 | 3300012944 | Vadose Zone Soil | FWDVDYVLRDDLVVNLGQRYFVTPRGEHTPVFSPWGFGALSSGRSETSLRLTFQF* |
Ga0163162_123386401 | 3300013306 | Switchgrass Rhizosphere | EPFWDVDYIVRNDLVVNIGQRYFVTPRGHNTPIFETWGLAGLNQGRSETTIRLTYQW* |
Ga0137418_107244142 | 3300015241 | Vadose Zone Soil | VVNLAQRYFVTPRGRSTPIFETWGLAGLNSGRSETSLRLTFQF* |
Ga0134073_102984712 | 3300015356 | Grasslands Soil | WSMEPFWTVTYVVRDDFVLNVAQRYFVTPKGRSTPIFESWGLGGLNNSRSETELVLTYQF |
Ga0134089_100872581 | 3300015358 | Grasslands Soil | IAQRYFVTPMGHSQPIFETWGLAGINGGRSETELRLTYQF* |
Ga0134089_103047641 | 3300015358 | Grasslands Soil | MEPFWTVSYVVRDDFVVNVAQRYFVTPKGHSTPIFETWGLGGFNHGRSETELVLTYQF* |
Ga0134089_105541442 | 3300015358 | Grasslands Soil | DYVVRDDFVVNLAQRYFVTPRGRETPIFETWGLAGLNSGRSETSLRLTFQF* |
Ga0182039_105208261 | 3300016422 | Soil | DLIVNLAQRYFIEPRGHSTPIFETWGLGGLNEGRSETSLRLTYQF |
Ga0134083_105569121 | 3300017659 | Grasslands Soil | TIRDDLVVNLTQRYFITPYGQSEPIFDPWGFSSMSAGRSETSLRFTYQF |
Ga0066667_102212511 | 3300018433 | Grasslands Soil | NVAQRYFVTPKGRSTPIFESWGLGGLNNSRSETELVLTYQF |
Ga0066667_111494712 | 3300018433 | Grasslands Soil | VVRDDLVVNLAQRYMVTPRGHHNPIFETWGLAGLNAGRSETSVRLTLQF |
Ga0066662_103413502 | 3300018468 | Grasslands Soil | VVNLAQRYFVTPRGRSTPIFETWGLAGLNSGRSETSLRLTFQF |
Ga0066662_116062242 | 3300018468 | Grasslands Soil | VVRDYFVVNIAQRYFVTPMGHSTPIFESWGLAGINSGRSETEVRLTYQF |
Ga0066669_100422311 | 3300018482 | Grasslands Soil | VVNLAQRYFVTPRGRETPIFETWGLAGLNSGRSETSLRLTFQF |
Ga0066669_109257293 | 3300018482 | Grasslands Soil | VNLAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF |
Ga0179594_103153982 | 3300020170 | Vadose Zone Soil | FVVNLAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF |
Ga0224500_102681812 | 3300022213 | Sediment | KDWLVFNLSQRYFVTPRGYGEPIYETWGIAGLNRGRSETVLRATFQF |
Ga0207693_106588322 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | YVLRDDLLINLAQRYFVTPRGQSTPIFSPWGFGAASRDRSETELRLTYQF |
Ga0207708_111710431 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | NDFVFNIGQRFFVTPNGHSEPIFETWGLAGFNAGRSETTIRLTYQF |
Ga0207648_113309011 | 3300026089 | Miscanthus Rhizosphere | EIGNDLVVNIGQRYFVTPRGHHTPIFETWGLAGLNQGRSETTIRLTYQW |
Ga0207675_1025264662 | 3300026118 | Switchgrass Rhizosphere | VNLSQRYMVTPRGHSTPIFETWGLGGLNAGRSETDIRLTWQF |
Ga0207675_1026119611 | 3300026118 | Switchgrass Rhizosphere | FWMVDYVVRDDFVINLSQRYIVTPRGHSTPIFSTWGLGSLNSGRSETDIRLTYQF |
Ga0209470_13542001 | 3300026324 | Soil | QRYFVTPMGHSTPIFETWGLAGINGDRSETELRLTYQF |
Ga0209375_10583511 | 3300026329 | Soil | AVDYVVRDDFVVNLAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF |
Ga0209473_12911112 | 3300026330 | Soil | LDYVVRDDFVVNLAQRYFVTPRGRSTPIFDTWGLGGLNNSRSETELRLTYQF |
Ga0209057_11955262 | 3300026342 | Soil | VDYVVRDDLVVNLAQRYFVTPRGHHDPIFQTWGLGSLAQGRSETSLRLTYQF |
Ga0209683_105430492 | 3300027840 | Wetland Sediment | NLGQRYYIQPHGHTTPIFETWGVAGLNAGRSETTLRVTYQF |
Ga0209382_107770152 | 3300027909 | Populus Rhizosphere | MVDYVVRDDFVINLSQRYIVTPRGHSTPIFSTWGLGSLNSGRSETNIRLTYQF |
Ga0268264_126545331 | 3300028381 | Switchgrass Rhizosphere | NQFAMEAFCDVDYVLRDDLVVNLGQRYFISPRGNSTPIFSPWGFGALSAGRSETSLRLTFQF |
Ga0137415_105015102 | 3300028536 | Vadose Zone Soil | RDDFVVNLAQRYFVTPRGRSTPIFETWGLAGLNSGRSETSLRLTFQF |
Ga0137415_109750532 | 3300028536 | Vadose Zone Soil | DYVLRDDFVINLAQRYFVNPRGKNQLYSAWGLAGLNSGRSETSIRLTYQF |
Ga0307429_11197281 | 3300031368 | Salt Marsh | FITPRGQSEPIFATWGLPSLSGRRSETSLRLTYQF |
Ga0170818_1043122053 | 3300031474 | Forest Soil | DDFVVNLAQRYFIEPRGHSSPIFETWGLGGLNADRSETSLRLTYQF |
Ga0318515_106961521 | 3300031572 | Soil | DLIVNLAQRYFIEPRGHSTPIFETWGLGGLNAGRSETSLRLTYQF |
Ga0318548_105954711 | 3300031793 | Soil | RYFITPRGHSTPIFETWGLGSLGAGRSETGLRLTYQF |
Ga0318557_104351441 | 3300031795 | Soil | VVRDDFVVNLAQRYFIEPRGRSTPIFETWGLGGLNAGRSETSLRLTYQF |
Ga0310904_112462571 | 3300031854 | Soil | VLPFWMVDYVVRDDFVINLSQRYIVTPRGQSTPIFSTWGIGSLNSGRSETNIRLTYQF |
Ga0310892_103835601 | 3300031858 | Soil | DDFVVNLSQRYFITPRGHSEPIFETWGLAGLNAGRSETALRLTYQY |
Ga0214473_114589741 | 3300031949 | Soil | TPSVGFTLSQHYFVTPKGHSEPIFETWGLSGLNAGRSETTVRLTYQF |
Ga0318525_106809831 | 3300032089 | Soil | RDDFVVNLAQRYFITPRGHSTPIFETWGLGGLNAGRSETSLRLTYQF |
Ga0315910_109976531 | 3300032144 | Soil | VNLAQRYFVTPRGHHEPSFETWGLAGLNAGRSETSLRLTYQY |
Ga0307471_1023190261 | 3300032180 | Hardwood Forest Soil | QFAMLPFWDLDYVLRDDFVVNVGQRYFVNPRGKEQLFSSWGLAGLNSGRSETSIRLTYQF |
Ga0307472_1017791713 | 3300032205 | Hardwood Forest Soil | VNLGQRYFVTPRGQSSPIFSPWGFGSLTGGRSETSLRLTYQF |
Ga0315270_108434221 | 3300032275 | Sediment | MEPFWTVDYVVRNDLVVNIGQRYFVTPRGNSTPIFETWGLADLNQGRSETSIRLTYQF |
Ga0315287_112012572 | 3300032397 | Sediment | VVNVGQRYFVTPRGHSDPIFETWGLGGLNAGRTETTIRLTYQF |
Ga0335070_104695492 | 3300032829 | Soil | MVVNVGQRYFVAPRGRSTPIFETWGLGGLSAGRSETTLRLTYQF |
⦗Top⦘ |