NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F103466

Metagenome Family F103466

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103466
Family Type Metagenome
Number of Sequences 101
Average Sequence Length 45 residues
Representative Sequence GWRVRASFPVNLPDYNIDKPRYLGVGVKDTVQVSVTFTATQS
Number of Associated Samples 93
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.98 %
% of genes near scaffold ends (potentially truncated) 95.05 %
% of genes from short scaffolds (< 2000 bps) 98.02 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil
(12.871 % of family members)
Environment Ontology (ENVO) Unclassified
(44.554 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(50.495 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 5.71%    β-sheet: 28.57%    Coil/Unstructured: 65.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF04264YceI 2.97
PF13620CarboxypepD_reg 0.99
PF04191PEMT 0.99
PF03022MRJP 0.99
PF01590GAF 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 2.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_100985135All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1399Open in IMG/M
3300000955|JGI1027J12803_102369103All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300000956|JGI10216J12902_110239193All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1366Open in IMG/M
3300003324|soilH2_10161666All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1842Open in IMG/M
3300004114|Ga0062593_102976485All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300004479|Ga0062595_101751819All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300004480|Ga0062592_102378567All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300005175|Ga0066673_10228763All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1071Open in IMG/M
3300005177|Ga0066690_10553171All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium770Open in IMG/M
3300005294|Ga0065705_10815978All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300005295|Ga0065707_10800096All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300005333|Ga0070677_10683868All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300005334|Ga0068869_100815781All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium803Open in IMG/M
3300005336|Ga0070680_100351836All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1253Open in IMG/M
3300005339|Ga0070660_101757049All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300005341|Ga0070691_10819623All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300005343|Ga0070687_100539555All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium792Open in IMG/M
3300005344|Ga0070661_101420180All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300005345|Ga0070692_10369917All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium896Open in IMG/M
3300005367|Ga0070667_100192725All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1806Open in IMG/M
3300005440|Ga0070705_101839518All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300005459|Ga0068867_100888778All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300005459|Ga0068867_101068299All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium735Open in IMG/M
3300005466|Ga0070685_10577289All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300005539|Ga0068853_101493164All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium654Open in IMG/M
3300005543|Ga0070672_100207301All Organisms → cellular organisms → Bacteria1641Open in IMG/M
3300005548|Ga0070665_101728260All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300005564|Ga0070664_100042495All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3836Open in IMG/M
3300005719|Ga0068861_100936810All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium823Open in IMG/M
3300006237|Ga0097621_100598105All Organisms → cellular organisms → Bacteria → Proteobacteria1008Open in IMG/M
3300006755|Ga0079222_11395004All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium648Open in IMG/M
3300006844|Ga0075428_102638504All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300006881|Ga0068865_100393929All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1133Open in IMG/M
3300006954|Ga0079219_11664566All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300009091|Ga0102851_11543732All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium742Open in IMG/M
3300009137|Ga0066709_101246456All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1093Open in IMG/M
3300009147|Ga0114129_13160165All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300009148|Ga0105243_11653142All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium668Open in IMG/M
3300009610|Ga0105340_1358300All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium646Open in IMG/M
3300010047|Ga0126382_10186288All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1462Open in IMG/M
3300010360|Ga0126372_12533660All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300011422|Ga0137425_1090292All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium734Open in IMG/M
3300011441|Ga0137452_1152360All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium778Open in IMG/M
3300011442|Ga0137437_1120869All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium901Open in IMG/M
3300012041|Ga0137430_1218060All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300012198|Ga0137364_10793362All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium715Open in IMG/M
3300012913|Ga0157298_10354957All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300012944|Ga0137410_10785364All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium799Open in IMG/M
3300012951|Ga0164300_10123526All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1174Open in IMG/M
3300012955|Ga0164298_10903959All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300012957|Ga0164303_10758062All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium662Open in IMG/M
3300012987|Ga0164307_10627416All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium832Open in IMG/M
3300014301|Ga0075323_1153588All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300014325|Ga0163163_10653197All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1115Open in IMG/M
3300014325|Ga0163163_11519311All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium731Open in IMG/M
3300014745|Ga0157377_10603711All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium783Open in IMG/M
3300015077|Ga0173483_10086580All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1277Open in IMG/M
3300015245|Ga0137409_10181344All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1907Open in IMG/M
3300015371|Ga0132258_10431813All Organisms → cellular organisms → Bacteria3280Open in IMG/M
3300015372|Ga0132256_100426698All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1430Open in IMG/M
3300015374|Ga0132255_100684513All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1522Open in IMG/M
3300015374|Ga0132255_100743584All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1459Open in IMG/M
3300017792|Ga0163161_12043894All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300018051|Ga0184620_10122905All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium820Open in IMG/M
3300018061|Ga0184619_10102878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1284Open in IMG/M
3300018920|Ga0190273_10796447All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium749Open in IMG/M
3300019362|Ga0173479_10359226All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium687Open in IMG/M
3300021344|Ga0193719_10151976All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium999Open in IMG/M
3300021344|Ga0193719_10224751All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium798Open in IMG/M
3300025893|Ga0207682_10498204All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300025922|Ga0207646_10174753All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1940Open in IMG/M
3300025930|Ga0207701_10588478All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium948Open in IMG/M
3300025930|Ga0207701_11405679All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300025940|Ga0207691_10162638All Organisms → cellular organisms → Bacteria → Proteobacteria1957Open in IMG/M
3300025940|Ga0207691_11590732All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300025960|Ga0207651_10699719All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium893Open in IMG/M
3300026035|Ga0207703_11662184All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300026067|Ga0207678_11035756All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium726Open in IMG/M
3300026095|Ga0207676_11053378All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium803Open in IMG/M
3300027775|Ga0209177_10283817All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300027880|Ga0209481_10637732All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300028379|Ga0268266_10868819All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium872Open in IMG/M
3300028381|Ga0268264_11100971All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium803Open in IMG/M
3300028381|Ga0268264_11791589All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300028889|Ga0247827_11117207All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300031152|Ga0307501_10259527All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300031538|Ga0310888_11038976All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300031547|Ga0310887_10835399All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300031740|Ga0307468_101169852All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium691Open in IMG/M
3300031820|Ga0307473_10920956All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300031847|Ga0310907_10324871All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300031854|Ga0310904_11424087All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300031943|Ga0310885_10140820All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1144Open in IMG/M
3300031943|Ga0310885_10344125All Organisms → cellular organisms → Bacteria → Acidobacteria781Open in IMG/M
3300032003|Ga0310897_10477259All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium602Open in IMG/M
3300032013|Ga0310906_10416125All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium892Open in IMG/M
3300032017|Ga0310899_10237761All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium822Open in IMG/M
3300032179|Ga0310889_10370291All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium705Open in IMG/M
3300033550|Ga0247829_11058427All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300033551|Ga0247830_10932365All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300034090|Ga0326723_0464285All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil12.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.89%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil4.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere4.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.97%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.97%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.98%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.98%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.99%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.99%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.99%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.99%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.99%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300011422Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2EnvironmentalOpen in IMG/M
3300011441Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300014301Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10098513513300000559SoilLRVKASFPVNLSDYSIRKPRYLGVGVKDTIQVEVAFAVIR*
JGI1027J12803_10236910313300000955SoilTVTGPVEVKKTGPGLRIKASFPVNLPDYNIPEPRYLGVGVKNTVQVEVIFTATQ*
JGI10216J12902_11023919323300000956SoilVRVDASFFVNLPDFGIAKPRYLGVGVKDQVQVKVSFGSAE*
soilH2_1016166633300003324Sugarcane Root And Bulk SoilGPAEIRQAGTGWRVRASFPINLPDYNIEKPRYLGVGVKDTVQVTVTFIARQS*
Ga0062593_10297648523300004114SoilGTLDVRQAGPALRVKASFPVLLSDYGIAKPRYLGVGVKDTVQVEVAFVVSR*
Ga0062595_10175181913300004479SoilQGTGLRVRASFAVDLPDYGIGKPRYLGVGVKDTVQVEVAFAVTR*
Ga0062592_10237856723300004480SoilVRQAGPALRVKASFPVLLSDYGIAKPRYLGVGVKDTVQVEVAFVVSR*
Ga0066673_1022876313300005175SoilVRPAGGGLRVKASFPVSLSDYGIPEPRYLGIGVRNTVQVEVAFAITQ*
Ga0066690_1055317123300005177SoilGLRVKASFPVSLSDYGIPEPRYLGIGVRNNVQVEVAFAVTQ*
Ga0065705_1081597813300005294Switchgrass RhizosphereIRQAGTGWRVRASFPVNLPDYNIDKPRYLGVGVKDTVQVSVTFTATQS*
Ga0065707_1080009613300005295Switchgrass RhizosphereGWRVRASFPVNLPDYNIDKPRYLGVGVKDTVQVSVTFTATQS*
Ga0070677_1068386813300005333Miscanthus RhizosphereTVTGSVEIRQAGAAWRVRASFPVNLPDYNIDKPRYLGVGVKDMVQVSVTFTATQS*
Ga0068869_10081578123300005334Miscanthus RhizosphereQAGAAWRVRASFPVNLPDYNIDKPRYLGVGVKDMVQVSVTFTATQS*
Ga0070680_10035183623300005336Corn RhizosphereGTGWRVRASFPVNLPDYNIDKPRYLGVGVKDTVQVSVTFTATQS*
Ga0070660_10175704913300005339Corn RhizosphereRESGTALRVKAVFPIALADYGIRQPRYLGVGVRDTVTVEVTFAVTN*
Ga0070691_1081962313300005341Corn, Switchgrass And Miscanthus RhizosphereDGGLRVKASFRLDLSDYGIAKPRYLGIGVTNTVRVEVAFDVSR*
Ga0070687_10053955513300005343Switchgrass RhizosphereGWRVRASFPVNLPDYNIDKPRYLGVGVKDTVQVSVTSTATQS*
Ga0070661_10142018013300005344Corn RhizosphereRVTASFPVNLPDYSIRKPRYLGVGVKDIVQVEVAFSVTR*
Ga0070692_1036991723300005345Corn, Switchgrass And Miscanthus RhizosphereAGLRVKASFPVNLHDYNIAEPRYLGVGVRDTVQVDVTFTTAQ*
Ga0070667_10019272533300005367Switchgrass RhizosphereAGAGLRVRASFPVNLPDYNIAEPRYLGVGVKDTVQVDVTFTTTQS*
Ga0070705_10183951813300005440Corn, Switchgrass And Miscanthus RhizosphereGLRVKASFPVELPAYGIDKPRYLGIGVKDIVRVEAAFAVTH*
Ga0068867_10088877813300005459Miscanthus RhizosphereAEIRQAGTGWRVRASFPVNLPDYNIDKPRYLGVGVKDTVQVSVTFTATQS*
Ga0068867_10106829913300005459Miscanthus RhizosphereVRAQGTGLRVRASFPVDLPDYGIGKPRYLGVGVKDTVQVEVAFAVTR*
Ga0070685_1057728923300005466Switchgrass RhizosphereTGTIDVRQAGTDVRVKASFPVTLPDYSIRKPRYLGVGVKDTVTVEVAFAMTR*
Ga0068853_10149316423300005539Corn RhizosphereTDVRVKASFPVTLPDYSIRKPRYLGVGVKDTVTVEVAFAMTR*
Ga0070672_10020730123300005543Miscanthus RhizosphereKTVTGTIDVRQAGTDVRVKASFPVTLPDYSIRKPRYLGVGVKDTVTVEVAFAMTR*
Ga0070665_10172826023300005548Switchgrass RhizosphereASFPVTLPDYSIRKPRYLGVGVKDTVTVEVAFAMTR*
Ga0070664_10004249513300005564Corn RhizosphereSFPVNLPDYNIAEPRYLGVGVKDTVQVDVTFTTTQS*
Ga0068861_10093681023300005719Switchgrass RhizosphereASFPVHLPEYNIAEPRYLGVGVKDTVQVDVTFITQ*
Ga0097621_10059810533300006237Miscanthus RhizosphereFRLDLPDYGIAKPRYLGVGVTNTVQVEVAFDVAR*
Ga0079222_1139500423300006755Agricultural SoilFPVNLPDYNIAEPRYLGVGVKNTVQVDVTFTTTQ*
Ga0075428_10263850423300006844Populus RhizosphereGPVEIRQAGAGWRVRASFPVNLPDYNIDKPRYLGVGVKDTVQVSVTFTATQS*
Ga0068865_10039392923300006881Miscanthus RhizosphereVDVRAQGTGLRVRASFPVDLPDYGIGKPRYLGVGVKDTVQVEVAFAVTR*
Ga0079219_1166456623300006954Agricultural SoilPVEIRKAGSGMRVRASFPVNLPDYNIPEPRYLGVGVKNTVQVDVTFTTTQ*
Ga0102851_1154373213300009091Freshwater WetlandsQSGAGLRVKASFLVTLADFSIRKPRYLGIGVKDTVQVDVAFAVTR*
Ga0066709_10124645613300009137Grasslands SoilGLRVKASFPVNLSDYGIRAPRYLGIGVRDTVQVEAAFAVSR*
Ga0114129_1316016523300009147Populus RhizosphereEIRQAGTAWRVRASFPVSLPDYNIEKPRYLGVGVRDTVQVSVTFTATQS*
Ga0105243_1165314213300009148Miscanthus RhizosphereTGPVEIRQAGAAWRVRASFPVNLPDYNIDKPRYLGVGVKDMVQVSVTFTATQS*
Ga0105340_135830023300009610SoilVKASFPVRLADYAISEPRYLGVGVKDTVEVNVTFSVAQGGQQ*
Ga0126382_1018628813300010047Tropical Forest SoilASFPVNLPDYNIDKPRYLGVGVKDTVQVLVTFTATQS*
Ga0126372_1253366023300010360Tropical Forest SoilSFPVNLPDYNIDKPRYLGVGVKDTVQVSVTFTATQT*
Ga0137425_109029223300011422SoilVKASFGLNVSDYGIAKPRYLGVGVANTVQVEVAFDVSR*
Ga0137452_115236023300011441SoilAVDVREAGTGLRVKASFPVDLSDYSIRKPRYLGIGVKDTVQVEVAFAVSR*
Ga0137437_112086933300011442SoilRVKASFRLDVSDYGIAPPRYLGIGVTNTVQVEVAFDVSR*
Ga0137430_121806023300012041SoilGGGLRVTASFRLDLADYGIARPSYLGIGVTNTVQVEVAFDVSR*
Ga0137364_1079336213300012198Vadose Zone SoilIKTSFPVNLPDYNIAEPRYLGVGVKNIVHVEVTFTTSQ*
Ga0157298_1035495723300012913SoilLRVQASFPVNLSDYSIRKPRYLGIGVKDIVQVEVAFAVTR*
Ga0137410_1078536423300012944Vadose Zone SoilRVKTSFPVNLPDYNIAEPRYLGVGVKNIVQVEVTFSATQ*
Ga0164300_1012352623300012951SoilGLHVKASFPVDLSDYAIAKPRYLGVGVKDIVQVEVAFAVTR*
Ga0164298_1090395923300012955SoilKRSVDVRAQRTRLRVRASFPVDLPDYGIGQPRYLGVDVKSTVQVEVAFAVTR*
Ga0164303_1075806213300012957SoilDVRQVGAALRVKASFPLNLTDYSIRQPRYLGVGVKDTVTVEVAFAVTR*
Ga0164307_1062741613300012987SoilDVRQAGTDVRVKASFPVTLPDYSIRKPRYLGVGVKDTVTVEVAFAMTR*
Ga0075323_115358813300014301Natural And Restored WetlandsKGGAGLRVKASFPVNLPDYNIPEPRYLGVGVKNTVQVEVTFTTTQ*
Ga0163163_1065319723300014325Switchgrass RhizosphereEVHPAGAGHRVKASFPVDLPAYAIPKPRYLGVGVKDTVHVEVAFEVSR*
Ga0163163_1151931113300014325Switchgrass RhizosphereIRQAGTGWRVRASFPVNLPDYNIDKPRYLGVGVKDTVQVSVTVTVTQS*
Ga0157377_1060371113300014745Miscanthus RhizosphereRASFPVNLPDYNIDKPRYLGVGVKDMVQVSVTFTATQS*
Ga0173483_1008658023300015077SoilTKPVTGFVDVRPAGGGRRVKASFRLDLTDYGIAKPRYLGIGVTNTVQVEVAFDVSR*
Ga0137409_1018134433300015245Vadose Zone SoilAGGGLQIKASFPITLSDYSISAPRYMGVGVKNTVQVQVAFAVTQ*
Ga0132258_1043181343300015371Arabidopsis RhizosphereVRASFPVTLADYSIRKPRYLGVGVKDTVTVEVAFAVTR*
Ga0132256_10042669823300015372Arabidopsis RhizosphereKASFPVNLADYSIRKPRYLGVGVKDTVTVEVAFAVTR*
Ga0132255_10068451333300015374Arabidopsis RhizosphereRQAGTGWRVRASFPVNLPDYNIDKPRYLGVGVKDTVQVSVTFTATQS*
Ga0132255_10074358413300015374Arabidopsis RhizosphereFPVLLSDYGIAKPRYLGVGVKDTVQVEVAFVVSR*
Ga0163161_1204389413300017792Switchgrass RhizosphereGAAWRVRASFPVNLPDYNIDKPRYLGVGVKDMVQVSVTFTATQS
Ga0184620_1012290513300018051Groundwater SedimentVTASFPVNLPDYSIRKPRYLGVGVKDIVQVEVAFAVTR
Ga0184619_1010287813300018061Groundwater SedimentTGAVDVRHAGAGLRVTASFPVNLSDYNIRKPRYLGVGVKDIVQVEVAFAVTR
Ga0190273_1079644723300018920SoilKASFPVNLSDYNISEPRYLGVGVKNTVQVEVAFTVTQ
Ga0173479_1035922613300019362SoilGAGHRVKASFPVDLPGYAIPKPRYLGVGVKDTVHVEVAFEVSR
Ga0193719_1015197623300021344SoilLHVTASFPVNLPDYSIRKPRYLGVGVKDIVQVEVAFSVTR
Ga0193719_1022475113300021344SoilVTGAVDVRQEGAALRVKASFPVLLSDYGIPKPRYLGVGVKDTVQVELVFAVSR
Ga0207682_1049820413300025893Miscanthus RhizosphereEIRQAGAAWRVRASFPVNLPDYNIDKPRYLGVGVKDMVQVSVTFTATQS
Ga0207646_1017475333300025922Corn, Switchgrass And Miscanthus RhizosphereRVRASFPVNLPDYNIAEPRYLGVGVKNTVQVDVTFTTTS
Ga0207701_1058847823300025930Corn, Switchgrass And Miscanthus RhizosphereSFPLNLPDYNIDKPRYLGVGVKDTVQVSVTFTATQS
Ga0207701_1140567923300025930Corn, Switchgrass And Miscanthus RhizosphereAAGLRVNAAFPINLSDYGVSEPRYMGVGVKNTVQVQVTFTVTQ
Ga0207691_1016263823300025940Miscanthus RhizosphereLRSVRQAGTDVRVKASFPVTLPDYSIRKPRYLGVGVKDTVTVEVAFAMTR
Ga0207691_1159073213300025940Miscanthus RhizosphereKASFRLKLSDYNIPEPRYLGVGVKDTVQVEVTFTASTP
Ga0207651_1069971913300025960Switchgrass RhizosphereAGTGWRVRASFPLNLPDYNIDKPRYLGVGVKDTVQVSVTVTVTQS
Ga0207703_1166218423300026035Switchgrass RhizosphereASFPVTLPDYSIRKPRYLGVGVKDTVTVEVAFAMTR
Ga0207678_1103575623300026067Corn RhizosphereGVRKTVKGSVDVRAQGTGLRVRASFPVDLPDYGIGKPRYLGVGVKDIVQVEVAFAVTR
Ga0207676_1105337823300026095Switchgrass RhizosphereGTIDVRQAGTDVRVKASFPVTLPDYSIRKPRYLGVGVKDTVTVEVAFAMTR
Ga0209177_1028381723300027775Agricultural SoilPVEIRKAGSGMRVRASFPVNLPDYNIPEPRYLGVGVKNTVQVDVTFTTTQ
Ga0209481_1063773213300027880Populus RhizosphereEIRQVGAAWRVRASFPVNLPDYNIEKPRYLGVGVKDTVQVSVTFTATQS
Ga0268266_1086881913300028379Switchgrass RhizosphereGVTKTVTGTIDVRQAGTDVRVNASFPVTLPDYSIRKPRYLGVGVKDTVTVEVAFAMTR
Ga0268264_1110097113300028381Switchgrass RhizosphereVEIRQAGTAWRVRASFPVNLPDYNIDKPRYLGVGVKDMVQVSVTFTATQS
Ga0268264_1179158923300028381Switchgrass RhizospherePVEIRQAGTGWRVRASFPVNLPDYNIDKPRYLGVGVKDTVQVDVTFITQ
Ga0247827_1111720713300028889SoilAGLRVKASFPVELADYSIRKPRYLGIGVRDTVQVEVVFALGRETRS
Ga0307501_1025952723300031152SoilEVKKTGSGLRVKASFPVNLPDYNIPEPRYLGVGVKNTVQVEVTFTATQ
Ga0310888_1103897623300031538SoilASFPVDLTSYGIRKPRYLGVGVKDIVQVEVAFVVSR
Ga0310887_1083539913300031547SoilVKASFPVDLATYRIRKPRYLGIGVKDIVQVEVAFAVSR
Ga0307468_10116985213300031740Hardwood Forest SoilKASFPLNLSDFGIREPRYLGVGVTNTVQVQVTFAVTH
Ga0307473_1092095623300031820Hardwood Forest SoilKTVTGPVEIRQAGTGWRVRASFPVNLPDYNIDKPRYLGVGVKDTVQVSVTFTTTQS
Ga0310907_1032487123300031847SoilVKASFPVELADYGIRKPRYLGIGVRDSVQVEVVFALGRETRS
Ga0310904_1142408713300031854SoilVRQAGTDVRVKASFPVTLPDYSIRKPRYLGVGVKDTVTVEVAFAMTR
Ga0310885_1014082013300031943SoilASFPVDLPAYGIGKPRYLGVGVKDTVQIEVAFAVTR
Ga0310885_1034412513300031943SoilLRVKASFPVQLSDYSIRPPRYLGVGVKDIVQVEVAFAVSR
Ga0310897_1047725913300032003SoilGGLRVQASFRLDLSDYNIAKPRYLGIGVTNTVQVEVAFDISR
Ga0310906_1041612513300032013SoilGLRVRASFPVDLPDYGIGKPRYLGVGVKDTVQIEVAFAVTR
Ga0310899_1023776123300032017SoilTAWRVRASFPVNLPDYNIDKPRYLGVGVKDMVQVSVTFTATQS
Ga0310889_1037029113300032179SoilSVDVRAQGTGLHVKASFPVDLSDYAIAKPRYLGVGVKDIVQVEVAFAVTR
Ga0247829_1105842723300033550SoilSQTVTGAVDVRQAGGGLRVKASFPVNLPDYRIRQPRYLGIGVTDTVRVEVVFAVSR
Ga0247830_1093236523300033551SoilGPDVRIDASFPVNLPEFGIPEPRYLGVGVKDQVQVKVKFGSAR
Ga0326723_0464285_447_5783300034090Peat SoilGSGLRVKASFPVNLSDYNIPEPRYLGVGVKNTVQVEVTFTATQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.