NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F103329

Metagenome Family F103329

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103329
Family Type Metagenome
Number of Sequences 101
Average Sequence Length 53 residues
Representative Sequence GGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP
Number of Associated Samples 89
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.94 %
% of genes near scaffold ends (potentially truncated) 73.27 %
% of genes from short scaffolds (< 2000 bps) 88.12 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.218 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(15.842 % of family members)
Environment Ontology (ENVO) Unclassified
(26.733 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(54.455 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.24%    β-sheet: 0.00%    Coil/Unstructured: 60.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF06226DUF1007 41.58
PF03781FGE-sulfatase 15.84
PF12697Abhydrolase_6 3.96
PF01297ZnuA 1.98
PF04966OprB 1.98
PF05649Peptidase_M13_N 1.98
PF00593TonB_dep_Rec 1.98
PF01431Peptidase_M13 1.98
PF01522Polysacc_deac_1 0.99
PF01527HTH_Tnp_1 0.99
PF10604Polyketide_cyc2 0.99
PF04551GcpE 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG3683ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 41.58
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 15.84
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 3.96
COG3659Carbohydrate-selective porin OprBCell wall/membrane/envelope biogenesis [M] 1.98
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.99
COG08214-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpELipid transport and metabolism [I] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.22 %
UnclassifiedrootN/A21.78 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_103618420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1384Open in IMG/M
3300004114|Ga0062593_100945836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales877Open in IMG/M
3300004156|Ga0062589_101144743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales740Open in IMG/M
3300004157|Ga0062590_102881085All Organisms → cellular organisms → Bacteria → Proteobacteria515Open in IMG/M
3300004643|Ga0062591_100560006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales999Open in IMG/M
3300005330|Ga0070690_100057113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2504Open in IMG/M
3300005330|Ga0070690_100122967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aurantimonas → Aurantimonas aggregata1744Open in IMG/M
3300005344|Ga0070661_100187185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1578Open in IMG/M
3300005347|Ga0070668_101095934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium719Open in IMG/M
3300005355|Ga0070671_100789108Not Available827Open in IMG/M
3300005365|Ga0070688_100982352Not Available670Open in IMG/M
3300005366|Ga0070659_100153072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1882Open in IMG/M
3300005435|Ga0070714_102209974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 65-9536Open in IMG/M
3300005457|Ga0070662_101149882All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales666Open in IMG/M
3300005518|Ga0070699_100246956Not Available1594Open in IMG/M
3300005530|Ga0070679_100253982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1714Open in IMG/M
3300005536|Ga0070697_100907813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales782Open in IMG/M
3300005549|Ga0070704_100523317Not Available1033Open in IMG/M
3300005577|Ga0068857_100196806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1836Open in IMG/M
3300005578|Ga0068854_100137222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1873Open in IMG/M
3300005834|Ga0068851_10073348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1775Open in IMG/M
3300005840|Ga0068870_11076008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales577Open in IMG/M
3300006050|Ga0075028_100326530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium861Open in IMG/M
3300006358|Ga0068871_102081083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales541Open in IMG/M
3300006755|Ga0079222_10138923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1359Open in IMG/M
3300006804|Ga0079221_10388081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales860Open in IMG/M
3300006847|Ga0075431_101148818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium740Open in IMG/M
3300006854|Ga0075425_101065085All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales921Open in IMG/M
3300006871|Ga0075434_100066210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3598Open in IMG/M
3300006904|Ga0075424_101369626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales752Open in IMG/M
3300006904|Ga0075424_101571940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales697Open in IMG/M
3300006914|Ga0075436_101422122All Organisms → cellular organisms → Bacteria → Proteobacteria526Open in IMG/M
3300009094|Ga0111539_10890531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1035Open in IMG/M
3300009094|Ga0111539_11068525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales938Open in IMG/M
3300009100|Ga0075418_10491991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus1316Open in IMG/M
3300009147|Ga0114129_12552665All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales610Open in IMG/M
3300009147|Ga0114129_13092317All Organisms → cellular organisms → Bacteria → Proteobacteria544Open in IMG/M
3300009147|Ga0114129_13390618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales513Open in IMG/M
3300009156|Ga0111538_10076552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi4259Open in IMG/M
3300009156|Ga0111538_10989425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1064Open in IMG/M
3300009162|Ga0075423_10616183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1144Open in IMG/M
3300009162|Ga0075423_10919004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales928Open in IMG/M
3300010046|Ga0126384_10032207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3491Open in IMG/M
3300010047|Ga0126382_10568333Not Available926Open in IMG/M
3300010373|Ga0134128_12955751Not Available523Open in IMG/M
3300010375|Ga0105239_10379873Not Available1597Open in IMG/M
3300010375|Ga0105239_12901243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium559Open in IMG/M
3300010400|Ga0134122_10351669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1284Open in IMG/M
3300012899|Ga0157299_10339399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales512Open in IMG/M
3300012957|Ga0164303_10090633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881486Open in IMG/M
3300012958|Ga0164299_10805073Not Available670Open in IMG/M
3300012984|Ga0164309_10275259Not Available1200Open in IMG/M
3300012984|Ga0164309_10571086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium878Open in IMG/M
3300012988|Ga0164306_10096763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881915Open in IMG/M
3300012989|Ga0164305_11841861Not Available548Open in IMG/M
3300013102|Ga0157371_10559598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium848Open in IMG/M
3300013306|Ga0163162_11340073Not Available814Open in IMG/M
3300014326|Ga0157380_12846249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales550Open in IMG/M
3300014745|Ga0157377_10081029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aurantimonas → Aurantimonas aggregata1898Open in IMG/M
3300015201|Ga0173478_10355866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales685Open in IMG/M
3300015372|Ga0132256_102104661Not Available670Open in IMG/M
3300016270|Ga0182036_10502061All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300017792|Ga0163161_10217011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1480Open in IMG/M
3300017926|Ga0187807_1110499Not Available867Open in IMG/M
3300017932|Ga0187814_10010829All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3552Open in IMG/M
3300017943|Ga0187819_10060896All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans2242Open in IMG/M
3300017959|Ga0187779_10515566Not Available792Open in IMG/M
3300017974|Ga0187777_10641980All Organisms → cellular organisms → Bacteria → Proteobacteria750Open in IMG/M
3300017974|Ga0187777_10789550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium678Open in IMG/M
3300017974|Ga0187777_10969410All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales614Open in IMG/M
3300018060|Ga0187765_10054346Not Available2070Open in IMG/M
3300021405|Ga0210387_10778659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium846Open in IMG/M
3300022892|Ga0247753_1057891Not Available510Open in IMG/M
3300025735|Ga0207713_1232737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales550Open in IMG/M
3300025906|Ga0207699_10183119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1409Open in IMG/M
3300025911|Ga0207654_10347239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1021Open in IMG/M
3300025917|Ga0207660_10108047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2089Open in IMG/M
3300025919|Ga0207657_10144411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1942Open in IMG/M
3300025920|Ga0207649_10271861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1229Open in IMG/M
3300025929|Ga0207664_10124544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2162Open in IMG/M
3300025929|Ga0207664_11837630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales528Open in IMG/M
3300025931|Ga0207644_10431477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1081Open in IMG/M
3300025940|Ga0207691_10224734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1627Open in IMG/M
3300026078|Ga0207702_10466260Not Available1227Open in IMG/M
3300026118|Ga0207675_101772502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium637Open in IMG/M
3300026142|Ga0207698_11118559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales801Open in IMG/M
3300026884|Ga0207455_1007727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales566Open in IMG/M
3300028809|Ga0247824_11008357All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium527Open in IMG/M
3300031547|Ga0310887_11112587Not Available507Open in IMG/M
3300031562|Ga0310886_10498648All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales734Open in IMG/M
3300031770|Ga0318521_10553299Not Available694Open in IMG/M
3300031854|Ga0310904_10908497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales622Open in IMG/M
3300031890|Ga0306925_10149375Not Available2514Open in IMG/M
3300031942|Ga0310916_11214399All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4623Open in IMG/M
3300031946|Ga0310910_10073077All Organisms → cellular organisms → Bacteria2480Open in IMG/M
3300032075|Ga0310890_10066616All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2129Open in IMG/M
3300032180|Ga0307471_101977960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium731Open in IMG/M
3300032205|Ga0307472_100174144Not Available1604Open in IMG/M
3300032211|Ga0310896_10562068Not Available632Open in IMG/M
3300032261|Ga0306920_103720860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium559Open in IMG/M
3300033290|Ga0318519_10818850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium573Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere15.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.95%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.95%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.97%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.98%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300022892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5EnvironmentalOpen in IMG/M
3300025735Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05K5-12 (SPAdes)EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10361842033300000955SoilMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP*
Ga0062593_10094583633300004114SoilYVKFLVDGGFLDRCIMQLPAADVTSKLIGWMRDHPEYDEKDWIDCLDDAIMNLKLCGP*
Ga0062589_10114474313300004156SoilTPEPCKAKVLAYVKFLVDGGFLDRCIMQLPAADVTSKLIGWMRDHPEYDEKDWVDCLDDAITTLKLCP*
Ga0062590_10288108513300004157SoilEKVLAYVKFLADGGFLDQCVMQLPAGDVAAKLVGWMRDHPEYRDRDWIDCVDDAIAALKLCNP*
Ga0062591_10056000613300004643SoilTPEPCKAKVLAYVKFLVDGGFLDRCIMQLPATDVTSKLIGWMRDHPEYDEKDWVACLDDAITTLKLCP*
Ga0070690_10005711333300005330Switchgrass RhizosphereMQLPAADVASKLIGWMRDHPEYSEKNWVDCLDDAITTLKLCDP*
Ga0070690_10012296743300005330Switchgrass RhizosphereKVLAYVKFLVDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP*
Ga0070661_10018718533300005344Corn RhizosphereYVKFLVDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP*
Ga0070668_10109593423300005347Switchgrass RhizospherePCKAKVLAYVKFLADGELLDPCIMQLPASDVAAKLIEWMHDHPEYSEKDCVDCLDDAIATLKLCKP*
Ga0070671_10078910813300005355Switchgrass RhizosphereVDGGFLDRCIMQLPAADVTSKLIGWMRDHPEYREKDWVDCLDDAITTLKLCDP*
Ga0070688_10098235213300005365Switchgrass RhizosphereMQLPAADVTSTIGWMRDHPEYDEKDWVDCLDDAITTLKLCP*
Ga0070659_10015307213300005366Corn RhizosphereEATPEPCKEKVLAYVKFLVDGGFLDQCIMQLPAADVTSKLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP*
Ga0070714_10220997413300005435Agricultural SoilAYVKFLTDAGFLDQCIMQRPASDVAAKLIGWMRDHPEYGEKDWVDCLDDAITTLKLCDP*
Ga0070662_10114988213300005457Corn RhizosphereVDGGILDQCVMQLPAGDVAAKLIGWMGDHPEYRDKDWVDCLDDAITMLKLCNP*
Ga0070699_10024695613300005518Corn, Switchgrass And Miscanthus RhizosphereMQLPAADVAAKLIGWMRDHPEYAEKDWVDCLDDAISTLKLCNP*
Ga0070679_10025398223300005530Corn RhizosphereKAKVLAYVKFLVDGGFLDRCIMQLPAADVTSKLIGWMRDHPEYDEKDWVDCLDDAITTLKLCP*
Ga0070697_10090781313300005536Corn, Switchgrass And Miscanthus RhizosphereLVDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP*
Ga0070704_10052331713300005549Corn, Switchgrass And Miscanthus RhizosphereVDGGFLDQCIMQLPAADVTSKLIGWMRNHPEYREKDWVDCLDDAITTLKLCDP*
Ga0068857_10019680613300005577Corn RhizosphereGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP*
Ga0068854_10013722213300005578Corn RhizosphereLAYVKFLADGGFLDQCIMQLPAADVASKLIGWMRDHPEYSEKNWVDCLDDAITTLKLCDP
Ga0068851_1007334813300005834Corn RhizosphereGFLDQCIMQLPAADVASKLIGWMRDHPEYSEKNWVDCLDDAITTLKLCDP*
Ga0068870_1107600823300005840Miscanthus RhizosphereCIMQLPAADVTSKLIGWMRDHPEYDEKDWVDCLDDAITTLKLCDP*
Ga0075028_10032653013300006050WatershedsFLNKCSTRVPTAEVAAKLIEWMRDHPEDAEEDWVDCLDDAVAALKLCSP*
Ga0068871_10208108313300006358Miscanthus RhizosphereVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP*
Ga0079222_1013892323300006755Agricultural SoilMRDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDALATLKLCNP*
Ga0079221_1038808113300006804Agricultural SoilLADGGFLDQCIMQLPAADVASKLIGWMRDHPEYSEKDWVDCLDDAITTLKLCDP*
Ga0075431_10114881823300006847Populus RhizosphereLAYVKFLAEGELLDPCIMQLPASDVAAKLIGWMRDHPEYSGKDWIDCLDDAIATLKLCKP
Ga0075425_10106508513300006854Populus RhizosphereLAYVKFLVDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKEWVDCLDDAIAALKLCNP
Ga0075434_10006621063300006871Populus RhizosphereKEKVLAYVKFLVDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKEWVDCLDDAIAALKLCNP*
Ga0075424_10136962623300006904Populus RhizosphereLPAGDVAAKLIGWMRDHPEYRDKDWVDCLDDAIDALKLCNP*
Ga0075424_10157194013300006904Populus RhizosphereDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKEWVDCLDDAIAALKLCNP*
Ga0075436_10142212213300006914Populus RhizosphereKEKVLAYVKFLVDGGILDQCVMQLPAGDVAAKLIGWMGDHPEYRDKDWIDCLDDAITMLKLCNP*
Ga0111539_1089053123300009094Populus RhizosphereVQAYVKFLTEGELLDPCIMQLPASDVAAKLIGWMRDHPEYSGKDWVDCLDDAIATLKLCKP*
Ga0111539_1106852523300009094Populus RhizosphereMQLPAADVTSKLIGWMRDHPEYDEKDWVDCLDDAIMNLKLCGP*
Ga0075418_1049199123300009100Populus RhizosphereVDGGFLDQCIMQLPAADVTSKLIGWMRDHPEYDEKDWVDCLDDAIMNLKLCGP*
Ga0114129_1255266513300009147Populus RhizosphereKVLAYVKFLADGGFLDQCIMQLPAADVASKLIGWMRDHPEYSEKNWVDCLDDAITTLKLCDP*
Ga0114129_1309231713300009147Populus RhizosphereKVLAYVKFLADGGFLDQCIMQLPAADVASKLIGWMRDHPEYGEKDWVDCLDDAITTVKLCDP*
Ga0114129_1339061813300009147Populus RhizosphereDVAAKLIGWMGDHPEYRDKDWVDCLDDAITMLKLCNP*
Ga0111538_1007655213300009156Populus RhizosphereFLVDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP*
Ga0111538_1098942513300009156Populus RhizosphereVDGGFLYQCIMQLPAADVTSKLIGWMRDHPEYDEKDWVDCLDDAIMNLKLCGP*
Ga0075423_1061618313300009162Populus RhizosphereEKVLAYVKFLVDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDALATLKLCNP*
Ga0075423_1091900423300009162Populus RhizosphereYVKFLVDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIAALKLCNP*
Ga0126384_1003220713300010046Tropical Forest SoilSRCTTRLPAADAAAELIGWMHDHPEAAGEDWVNCLDDAVAALKLCSP*
Ga0126382_1056833313300010047Tropical Forest SoilTTRLPAADAAAELIGWMHDHPEAAGEDWVNSLDDAVAALKLCSP*
Ga0134128_1295575123300010373Terrestrial SoilVDGGFLDQCIMQLPAADVTSKLIGWMRNHPEYREKDWVDCLDDAITTLKLCP*
Ga0105239_1037987313300010375Corn RhizosphereMQLPAADVTSKLIGWMRNHPEYREKDWVDCLDDAIATLKLCKP*
Ga0105239_1290124323300010375Corn RhizosphereMQLPASDVAAKLIGWIRDHPEYSGKDWVDCLDDAIATLKLCKP*
Ga0134122_1035166923300010400Terrestrial SoilHCEATPEPCKEKVLAYVKFLVDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP*
Ga0157299_1033939913300012899SoilLPAGDVAAKLIGWMRDHPEYRDKDWVDCLDDAITTLKLCDP*
Ga0164303_1009063333300012957SoilEAAPEPCKEKVLAYVKFLTEGELLDPCIMQLPASDVAAKLIGWMRDHPEYSGKDWVDCLDDAIATLKLCKP*
Ga0164299_1080507323300012958SoilPEPCKEKILEYVKFLADGGLIDGCVLQLPANAVAAKLIGYMHDHAESGDKDWVDCLDDAIATLKLCNP*
Ga0164309_1027525933300012984SoilAADVATKLIEWMRDHPEYSGKDWVDCLDDAVAALKLCNS*
Ga0164309_1057108613300012984SoilKEKVLAYVKFLADGGFLNQCIMKLPAADVAAKLIGWMRDHPDYAEKDWVDCLDDGISTLKLCNP*
Ga0164306_1009676333300012988SoilCKEKVLAYVKFLAEGGQVDRCIMQLPASEVAAKLITWMRDHPDYSQKDWVDCLDDAIATLKLCKP*
Ga0164305_1184186113300012989SoilANAVAAKLIGYMHDHAESGDKDWVDCLDDAIATLKLCNP*
Ga0157371_1055959833300013102Corn RhizosphereMQLPAADVTSTIGWMRDHPEYDEKDWVDCLDDAIT
Ga0163162_1134007313300013306Switchgrass RhizosphereMQLPAADVTSKLIGWMRDHPEYDEKDWVDCLDDAITTLKL
Ga0157380_1284624923300014326Switchgrass RhizosphereCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP*
Ga0157377_1008102933300014745Miscanthus RhizosphereVDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP*
Ga0173478_1035586623300015201SoilMQLPAGDVAANLIGWMRDHPEYDEKDWVDCLDDAIVTLKLCNP*
Ga0132256_10210466113300015372Arabidopsis RhizosphereMQRPASDVAAKLIGWMRDHPEYGEKNWVDCLDDAITALKLCDP*
Ga0182036_1050206123300016270SoilMQLPAGDVAAKLIGWMRDHPEYRDKDWIDCLDAAIAALKLCSP
Ga0163161_1021701133300017792Switchgrass RhizosphereFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP
Ga0187807_111049913300017926Freshwater SedimentDAVAAKLIGYMRDHPAKEWIDCLDDAVATLKLCNP
Ga0187814_1001082913300017932Freshwater SedimentHCQAAPGPCKAKVLAYVKFLADGEFIDPCILQLPADAVAAKLIGYMRDHPAKEWIDCLDDAVATLKLCNP
Ga0187819_1006089613300017943Freshwater SedimentKVLAYVKFLADGEFIDPCILQLPADAVAAKLIGYMRDHPAKEWIDCLDDAVATLKLCNP
Ga0187779_1051556623300017959Tropical PeatlandMHLPADTVAAKLIGYMRDHPAKEWIDCLDDAIATLKLCNP
Ga0187777_1064198033300017974Tropical PeatlandMQLPADTVAAKLIGYMRDHPAKEWIDCLDDAIATLKLCN
Ga0187777_1078955023300017974Tropical PeatlandILAYVKFLADAGFVNQCIVQLPASDVAAKLIGWMRDHPKYGEKDWVDCLDDAITALKLCN
Ga0187777_1096941013300017974Tropical PeatlandGPCKEKILAYVKFLADGEFIDPCILQLPADAVAAKLIRYMRDHPAQEWIDCLDDAVATLELCTP
Ga0187765_1005434633300018060Tropical PeatlandMHLPADTVASKLIAYMRDHPAKEWIDCLDDAIATLKLCNP
Ga0210387_1077865923300021405SoilEKALPYVKFLADGGFLNKCSTRLPAAEVAAKLIQWMRDHPEDAEEDWVDCLDDAVAALKPCSP
Ga0247753_105789123300022892SoilADGGFLDQCIMQLPAADVASKLIGWMRDHPEYSEKNWVDCLDDAITTLKLCDP
Ga0207713_123273723300025735Switchgrass RhizosphereFLDQCIMQLPAADVASKLIGWMRDHPEYSEKNWVDCLDDAITTLKLCDP
Ga0207699_1018311923300025906Corn, Switchgrass And Miscanthus RhizosphereTPEPWKEKVLAYVKFLVDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP
Ga0207654_1034723923300025911Corn RhizosphereMQLPAADVASKLIGWMRDHPEYSEKNWVDCLDDAITTLKLCDP
Ga0207660_1010804723300025917Corn RhizosphereKVLAYVKFLADGGFLDQCIMQLPAADVASKLIGWMRDHPEYSEKNWVDCLDDAITTLKLCDP
Ga0207657_1014441113300025919Corn RhizosphereGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP
Ga0207649_1027186113300025920Corn RhizosphereYVKFLVDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP
Ga0207664_1012454443300025929Agricultural SoilKVLAYVKFLVDGGFLDQCIMQLPAGDVAAKLIGWMRDHPEYREKDWVDCLDDALAALKLCKP
Ga0207664_1183763013300025929Agricultural SoilQFLVGGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP
Ga0207644_1043147723300025931Switchgrass RhizosphereEATPEPCKAKVLAYVKFLVDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP
Ga0207691_1022473423300025940Miscanthus RhizosphereLLGTHPPEPCKEKVLAYVKFLVDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP
Ga0207702_1046626023300026078Corn RhizosphereVDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP
Ga0207675_10177250223300026118Switchgrass RhizosphereMQLPASDVAAKLIGWIRDHPEYSGKDWVDCLDDAIATLKLCKP
Ga0207698_1111855913300026142Corn RhizosphereLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP
Ga0207455_100772713300026884SoilDVASKLIGWMRDHPEYSEKNWVDCLDDAITTLKLCDP
Ga0247824_1100835723300028809SoilEPCKAKVLAYVKFLADGELVDPCIMQLPASDVAAKLITWMRDLPDYSEKDWVDCLDDAIATLKLCKR
Ga0310887_1111258723300031547SoilEATPEPCKEKVLAYVKFLVDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP
Ga0310886_1049864823300031562SoilDQCIMQLPAADVASKLIGWMRDHPEYSEKNWVDCLDDAITTLKLCDP
Ga0318521_1055329923300031770SoilMQLPAGDVAAKLIRWMRDHPEYRDKDWIDCLDDAIAALKLCSP
Ga0310904_1090849713300031854SoilFLVDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP
Ga0306925_1014937523300031890SoilMQLPAGDVAAKLIGWMRDHPEYRDKDWIDCLDDAIAALKLCSP
Ga0310916_1121439913300031942SoilMQLPAGNVAAKLIGWMRDHPEYRDKDWIDCLDEAIA
Ga0310910_1007307713300031946SoilMQLPAGDVAAKLIGWMRDHPEYREKDWIDCLDDAIAALKLCSP
Ga0310890_1006661613300032075SoilHCEATPEPCKEKVLAYVKFRVDGGFLDQCVMQLPAGDVAANLIGWMRDHPEYRDKDWVDCLDDAIATLKLCNP
Ga0307471_10197796023300032180Hardwood Forest SoilAEGELVDPCIMQLPASEVAAKLIRWMRDHPDYSEKDWVDCLDDAIATLKLCKP
Ga0307472_10017414423300032205Hardwood Forest SoilMQLPASDVAAKLITWMRDHPDYSEKDWVDCLDDAIATLKLCKR
Ga0310896_1056206823300032211SoilMQLPAADVTSTIGWMRDHPEYDEKDWVDCLDDAIMNLKLCGP
Ga0306920_10372086023300032261SoilVLAYVKFLAEGGLLDPCVMQQPAAHVATELIGWMRDHTEYAEKDWVDCLDDAISTLKLCN
Ga0318519_1081885013300033290SoilGGFLRQCITRLPAADTGAKLIEWMRDHPEEGEEDWVDCLDNAVAALKLCNP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.