Basic Information | |
---|---|
Family ID | F103234 |
Family Type | Metagenome |
Number of Sequences | 101 |
Average Sequence Length | 50 residues |
Representative Sequence | MIEVIQEVRGAYTYVESSYLNIIRVGNEVLNADVTTEITAQETIINDYI |
Number of Associated Samples | 81 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 9.90 % |
% of genes from short scaffolds (< 2000 bps) | 77.23 % |
Associated GOLD sequencing projects | 71 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.72 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (83.168 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (22.772 % of family members) |
Environment Ontology (ENVO) | Unclassified (61.386 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (52.475 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.38% β-sheet: 29.87% Coil/Unstructured: 46.75% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.72 |
Powered by PDBe Molstar |
SCOP family | SCOP domain | Representative PDB | TM-score |
---|---|---|---|
c.51.2.1: TolB, N-terminal domain | d2hqsa2 | 2hqs | 0.77964 |
d.50.2.0: automated matches | d4htga2 | 4htg | 0.76648 |
c.55.3.15: PIWI domain C-terminal | d2bgga3 | 2bgg | 0.7564 |
c.55.1.0: automated matches | d2w40a1 | 2w40 | 0.75631 |
c.51.5.1: CinA-like | d2a9sa1 | 2a9s | 0.73437 |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF14550 | Peptidase_S78_2 | 5.00 |
PF04404 | ERF | 2.00 |
PF04136 | Sec34 | 1.00 |
PF03330 | DPBB_1 | 1.00 |
PF00145 | DNA_methylase | 1.00 |
PF09250 | Prim-Pol | 1.00 |
PF13604 | AAA_30 | 1.00 |
PF13385 | Laminin_G_3 | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352003|2199765357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3014 | Open in IMG/M |
3300000882|FwDRAFT_10252265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300001273|B570J13893_100051 | All Organisms → Viruses | 9279 | Open in IMG/M |
3300002447|JGI24768J34885_10001385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 7546 | Open in IMG/M |
3300002835|B570J40625_101016518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
3300003277|JGI25908J49247_10073876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
3300003277|JGI25908J49247_10105858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300003394|JGI25907J50239_1070618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
3300005581|Ga0049081_10048247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1614 | Open in IMG/M |
3300005581|Ga0049081_10100268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1080 | Open in IMG/M |
3300005581|Ga0049081_10113664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1004 | Open in IMG/M |
3300005582|Ga0049080_10071922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1185 | Open in IMG/M |
3300005582|Ga0049080_10208772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300005583|Ga0049085_10124014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
3300005662|Ga0078894_10285805 | All Organisms → Viruses → Predicted Viral | 1497 | Open in IMG/M |
3300005955|Ga0073922_1005547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1443 | Open in IMG/M |
3300006484|Ga0070744_10152412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300006641|Ga0075471_10038561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2712 | Open in IMG/M |
3300006805|Ga0075464_10304294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
3300007177|Ga0102978_1317446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1580 | Open in IMG/M |
3300008107|Ga0114340_1049348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1848 | Open in IMG/M |
3300008110|Ga0114343_1014524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3673 | Open in IMG/M |
3300008113|Ga0114346_1000834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28669 | Open in IMG/M |
3300008267|Ga0114364_1174461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300008996|Ga0102831_1073229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1142 | Open in IMG/M |
3300009026|Ga0102829_1007701 | All Organisms → Viruses → Predicted Viral | 2953 | Open in IMG/M |
3300009037|Ga0105093_10546297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
3300009059|Ga0102830_1082494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
3300009081|Ga0105098_10294625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
3300009082|Ga0105099_10845563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300009163|Ga0114970_10000807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 23742 | Open in IMG/M |
3300009165|Ga0105102_10920233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300009181|Ga0114969_10000611 | All Organisms → Viruses | 30776 | Open in IMG/M |
3300009185|Ga0114971_10263134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
3300010354|Ga0129333_10123369 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2385 | Open in IMG/M |
3300010354|Ga0129333_10235454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1655 | Open in IMG/M |
3300010354|Ga0129333_10591111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
3300010354|Ga0129333_11159482 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 643 | Open in IMG/M |
3300012667|Ga0157208_10010749 | All Organisms → Viruses → Predicted Viral | 1284 | Open in IMG/M |
3300012667|Ga0157208_10013498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1117 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10013586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8318 | Open in IMG/M |
(restricted) 3300013127|Ga0172365_10812541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
(restricted) 3300013128|Ga0172366_10106039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1872 | Open in IMG/M |
(restricted) 3300013133|Ga0172362_10128935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1882 | Open in IMG/M |
(restricted) 3300013137|Ga0172375_10922851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
3300017716|Ga0181350_1033569 | All Organisms → Viruses → Predicted Viral | 1406 | Open in IMG/M |
3300017716|Ga0181350_1033569 | All Organisms → Viruses → Predicted Viral | 1406 | Open in IMG/M |
3300017736|Ga0181365_1088035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
3300017774|Ga0181358_1266954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300017777|Ga0181357_1252334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300017780|Ga0181346_1104365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1097 | Open in IMG/M |
3300017784|Ga0181348_1099069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1139 | Open in IMG/M |
3300020048|Ga0207193_1247501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1349 | Open in IMG/M |
3300020048|Ga0207193_1753367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
3300020159|Ga0211734_11005561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300020159|Ga0211734_11206261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1089 | Open in IMG/M |
3300020162|Ga0211735_10206485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3572 | Open in IMG/M |
3300020172|Ga0211729_10775934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32346 | Open in IMG/M |
3300020503|Ga0208363_1015683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
3300020513|Ga0208090_1031411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
3300020525|Ga0207938_1012056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1563 | Open in IMG/M |
3300020561|Ga0207934_1037459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
3300020575|Ga0208053_1016729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1455 | Open in IMG/M |
3300022407|Ga0181351_1042670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1912 | Open in IMG/M |
3300024346|Ga0244775_10691613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
3300024346|Ga0244775_11055649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
3300024346|Ga0244775_11085362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300025732|Ga0208784_1145437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300026931|Ga0209850_1001663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2031 | Open in IMG/M |
3300027320|Ga0208923_1051755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
3300027659|Ga0208975_1152141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300027736|Ga0209190_1000387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32283 | Open in IMG/M |
3300027754|Ga0209596_1000708 | All Organisms → Viruses | 30780 | Open in IMG/M |
3300027772|Ga0209768_10193745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
3300027785|Ga0209246_10100485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1133 | Open in IMG/M |
3300027798|Ga0209353_10011994 | All Organisms → Viruses → Predicted Viral | 4182 | Open in IMG/M |
3300027808|Ga0209354_10309279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300027836|Ga0209230_10241180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1042 | Open in IMG/M |
3300027956|Ga0209820_1129223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
3300032093|Ga0315902_10013132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10732 | Open in IMG/M |
3300033984|Ga0334989_0050040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2292 | Open in IMG/M |
3300033984|Ga0334989_0472370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300033995|Ga0335003_0256861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
3300033995|Ga0335003_0339532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300034019|Ga0334998_0560399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300034051|Ga0335024_0188933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1103 | Open in IMG/M |
3300034051|Ga0335024_0550209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300034062|Ga0334995_0406721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
3300034066|Ga0335019_0403538 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 835 | Open in IMG/M |
3300034095|Ga0335022_0022603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4138 | Open in IMG/M |
3300034095|Ga0335022_0152644 | All Organisms → Viruses → Predicted Viral | 1426 | Open in IMG/M |
3300034105|Ga0335035_0001221 | All Organisms → Viruses | 19194 | Open in IMG/M |
3300034105|Ga0335035_0661785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300034106|Ga0335036_0734539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300034107|Ga0335037_0034354 | All Organisms → Viruses → Predicted Viral | 2722 | Open in IMG/M |
3300034110|Ga0335055_0205627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 871 | Open in IMG/M |
3300034116|Ga0335068_0000495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31047 | Open in IMG/M |
3300034116|Ga0335068_0125334 | All Organisms → Viruses → Predicted Viral | 1415 | Open in IMG/M |
3300034116|Ga0335068_0580468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300034119|Ga0335054_0411766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
3300034121|Ga0335058_0184621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1220 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 22.77% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 15.84% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 7.92% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 6.93% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.95% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.95% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.96% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.96% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.96% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.96% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.96% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.97% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.97% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.98% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.98% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.98% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.98% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.99% |
Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.99% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352003 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
3300001273 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020503 | Freshwater microbial communities from Lake Mendota, WI - 03MAY2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020513 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020525 | Freshwater microbial communities from Lake Mendota, WI - 05MAR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020561 | Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020575 | Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026931 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 (SPAdes) | Environmental | Open in IMG/M |
3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034051 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
2199913838 | 2199352003 | Freshwater | MIEVIQEVRGAYTYVESSYLNIIKVGNEVLNADVTAEITAQETIINDYI |
FwDRAFT_102522651 | 3300000882 | Freshwater And Marine | MIEVYQEVRGAYTYVESSYSNIIKVGNEVLNADVTAEITAQETIINDYI* |
B570J13893_10005116 | 3300001273 | Freshwater | MIEVIQEVRGAYTYVESSYLNIIKVGNEVLNADVTAEITAQETIINDYI* |
JGI24768J34885_100013851 | 3300002447 | Freshwater And Sediment | MIEVYKEVRGAYTYVESSYSDIIRVGNEVLNAGVTTEITAQETIINNYI* |
B570J40625_1010165182 | 3300002835 | Freshwater | MIEVIQEVRGAYTYVESSYTNIIKVGNEVLNANVTDEITAQETIINNYI* |
JGI25908J49247_100738761 | 3300003277 | Freshwater Lake | MIEVIQEVRGAYTYVESTYLNIIRVGNEVLNADVTTEITAQETIINNYI* |
JGI25908J49247_101058583 | 3300003277 | Freshwater Lake | MITVIQEIRGSYTYVESRYLNVIIVGNEVLNANVSAEIINQETIINNYI* |
JGI25907J50239_10706181 | 3300003394 | Freshwater Lake | VRGAYTYVESTYLNIIRVGNEVLNADVTTEITAQETIINNYI* |
Ga0049081_100482474 | 3300005581 | Freshwater Lentic | MIEVYQEVRGAYTYVESSYLNIIRVGNEVLNADVTTEMTAQETIINDYI* |
Ga0049081_101002683 | 3300005581 | Freshwater Lentic | MIEVIQDLRGDYTYVESSYSNIIKVGNEVLNASVTTEITNQETIINNYI* |
Ga0049081_101136642 | 3300005581 | Freshwater Lentic | MIEVIQDLRGDYTYVETSYLNIIKVGNEVLNADVSTEITNQETIINNYI* |
Ga0049080_100719222 | 3300005582 | Freshwater Lentic | MIEVIQDLRGDYTYVESSYLNIIKVGNEVLNADVSTEITNQETIINNYI* |
Ga0049080_102087722 | 3300005582 | Freshwater Lentic | MITVFQEVRGAYTYVESSYLNIIRVGNEVLNADVTTEITAQETIINDYI* |
Ga0049085_101240142 | 3300005583 | Freshwater Lentic | MITVIQEIRGAYTYVESSYLNVIKIGNEVLNANVTAEITAQETIIKSNR* |
Ga0078894_102858052 | 3300005662 | Freshwater Lake | MIEVYQEVRGAYTYVESSYSNIIKVGNEVLNADVATEITAQETIINDYI* |
Ga0073922_10055472 | 3300005955 | Sand | MIEVIQEVRGAYTYVESVYSNTIRVGNEVLNADVSTEITNQETIINDYIASL* |
Ga0070744_101524121 | 3300006484 | Estuarine | MIEVIQEVRGAYTYVESSYLNIIRVGNEVLNADVTTEITAQETIINDYI* |
Ga0075471_100385612 | 3300006641 | Aqueous | MIEVIQEVRGAYTYVESSYSNIIKVGNEVLNADVSTEITNQETIINDYIASL* |
Ga0075464_103042942 | 3300006805 | Aqueous | MIEVFQEVRGAYTYVESSYLNIIRVGNEVLNADVTTEITAQETIINDYI* |
Ga0102978_13174464 | 3300007177 | Freshwater Lake | MIEVYQEVRGAYTYVESSYSNIIKVGNEVLNADVAAEITTQETIINDYI* |
Ga0114340_10493482 | 3300008107 | Freshwater, Plankton | GDYTYVESSYLNIIRVGNEVLNANVSSEITAQETIINDYIASL* |
Ga0114343_10145244 | 3300008110 | Freshwater, Plankton | MIEVIQEVRGTYTYVESSYSTIIKVGNEVLNADVSTEITAQETIINDYIASL* |
Ga0114346_10008346 | 3300008113 | Freshwater, Plankton | MIEVIQEVRGSYTYVESSYSNIIRVGNEVLNANVSSEITAQETIINDYIASL* |
Ga0114364_11744612 | 3300008267 | Freshwater, Plankton | MIEVIQEVRGSYTYVESSYSNIIKVGNEVLNADVSTEITVQETIINDYIASL* |
Ga0102831_10732293 | 3300008996 | Estuarine | MIEVIQDLRGDYTYVESSYSNIIKVGNEVLNADVSTEITNQETIINNYI* |
Ga0102829_10077015 | 3300009026 | Estuarine | MIEVFQEVRGAYTYVESSYLNIIRVGNEVLNADVTTEITAQETIINNYI* |
Ga0105093_105462972 | 3300009037 | Freshwater Sediment | MIEVYQEVRGAYTYVESSYSNIIKVGNEVLNADVTSEITAQETIINDYI* |
Ga0102830_10824942 | 3300009059 | Estuarine | MITVITEVRGAYTYVESSYLNIIKIGNEVLNANVSSEITAQETIINDYIASL* |
Ga0105098_102946252 | 3300009081 | Freshwater Sediment | MIEVIQEVRGSYTYVESSYSNLIKVGNEVLNTDVSAEILNQETIINDYIASL* |
Ga0105099_108455632 | 3300009082 | Freshwater Sediment | MIEVYQEVRGAYTYVESSYLNIIRVGNEVLNADVTTEITAQETIINDYI* |
Ga0114970_1000080729 | 3300009163 | Freshwater Lake | MITVYQEIRGAYTYVESSYLNVIKIGNEVLNANVTAEITAQETIINNYI* |
Ga0105102_109202332 | 3300009165 | Freshwater Sediment | MIEVIQEIRGSYTYVESSYSNIIRVGNEVLNANVSSEITAQETIINDYIASL* |
Ga0114969_1000061137 | 3300009181 | Freshwater Lake | MIEVYQEVRGAYTYVESTYLNIIRVGNEVLNADVTTEITAQETIINDYI* |
Ga0114971_102631343 | 3300009185 | Freshwater Lake | MITVITEVIGDYTYIESSYSNIIKVGNEVLNANVAAEILIQETIINDYI* |
Ga0129333_101233691 | 3300010354 | Freshwater To Marine Saline Gradient | MIEVIQEVRGAYTYVESSYSNIIKVGNEVLNADVSTEITAQETIINDYIASL* |
Ga0129333_102354543 | 3300010354 | Freshwater To Marine Saline Gradient | MIEVIQEVRGDYTYVESSYSNIIKVGNEVLNANVSTEITNQETIINDYIASL* |
Ga0129333_105911112 | 3300010354 | Freshwater To Marine Saline Gradient | MIEVIQEVRGAYTYVESSYSNIIKVGNEVLNADVSAEITNQETIINDYIASL* |
Ga0129333_111594821 | 3300010354 | Freshwater To Marine Saline Gradient | MIEVIQEVRGAYTYVESSYSNIIKVGNEVLNADVSTEITNQETIVNDYIASL* |
Ga0157208_100107491 | 3300012667 | Freshwater | MIEVIQEVRGAYTYVESSYLNIIKVGSEVLNADVATEITAQETIINDYI* |
Ga0157208_100134981 | 3300012667 | Freshwater | MIEVYQEVRGAYTYVESTYLNIIKVGNEVLNADVATEITAQ |
(restricted) Ga0172367_100135869 | 3300013126 | Freshwater | MIEVIQEVRGAYTYVESSYLTLIKVGNEVLNADVTTEITAQENIINDYIATL* |
(restricted) Ga0172365_108125412 | 3300013127 | Sediment | MIEVIQEVRGAYTYVESSYLNLIKIGNEVLNADVTTEITAQENIINDYIATL* |
(restricted) Ga0172366_101060392 | 3300013128 | Sediment | MIEVIQEVRGAYTYVESSYLTLIKIGNEVLNADVTTEITAQENIINDYIATL* |
(restricted) Ga0172362_101289352 | 3300013133 | Sediment | MIEVIQEVRGAYTYVESSYLNLIKIGNEVLNADVTTEITAQENIINDYIASL* |
(restricted) Ga0172375_109228512 | 3300013137 | Freshwater | MIEVIQEVRGAYTYVESSYLTLIKVGNEVLNADVTTEITAQENIINDYIA |
Ga0181350_10335693 | 3300017716 | Freshwater Lake | MITVIQEIRGAYTYVESSYLNVIKIGNEVLNANVTAEITAQETIIKSNR |
Ga0181350_10335695 | 3300017716 | Freshwater Lake | INYKLCVMITVIQEIRGAYTYVESSYLNVIKIGNEVLNANVTAEITAQETIIKSNRR |
Ga0181365_10880351 | 3300017736 | Freshwater Lake | MITVIQEIRGAYTYVESSYLNVIKVGNEVLNANVTAEITAQETIIKSNR |
Ga0181358_12669541 | 3300017774 | Freshwater Lake | RGSYTYVESRYLNVIIVGNEVLNANVSAEIINQETIINNYI |
Ga0181357_12523342 | 3300017777 | Freshwater Lake | MITVYQEIRGAYTYVESSYLNAIKVGNEVLNANVTAEITAQETIINNYI |
Ga0181346_11043651 | 3300017780 | Freshwater Lake | MIEVTTEVRGAYTYVESTYLNIIRVGNEVLNADVTTEIIAQETIINDYI |
Ga0181348_10990692 | 3300017784 | Freshwater Lake | MIEVTTEVRGAYTYVESTYLNIIRVGNEVLNADVTTEITAQETIINNYI |
Ga0207193_12475013 | 3300020048 | Freshwater Lake Sediment | MIEVIQDLRGDYTYVESSYLNIIKVGNEVLNADVSTEITNQETIINNYI |
Ga0207193_17533672 | 3300020048 | Freshwater Lake Sediment | MIEVYQEVRGAYTYVESTYLNIIRVGNEVLNADVTSEITAQETIINNYI |
Ga0211734_110055612 | 3300020159 | Freshwater | MIEVIQEVRGAYTYVESSYSNIIKVGNEVLNADVATEITAQETIINDYI |
Ga0211734_112062612 | 3300020159 | Freshwater | MIEVIQEVRGAYTYVESSYSNIIKVGNEVLNADVSTEITTQETIINDYIASL |
Ga0211735_102064853 | 3300020162 | Freshwater | MIEVTQDVRGSYTYVESSYSNIIRVGNEVLNANVSSEITAQETIINDYIASL |
Ga0211729_1077593417 | 3300020172 | Freshwater | MIEVIQEIRGSYTYVESSYLNVIKIGNEVLNADVTSEITIQENMINDYI |
Ga0208363_10156831 | 3300020503 | Freshwater | TINIKLFGMIEVYQEVRGAYTYVESSYSNIIRVGNEVLNADVTTEITAQETIINDYI |
Ga0208090_10314112 | 3300020513 | Freshwater | MIEVIQEVRGAYTYVESVYFNIIRVGNEVLNADVSTEITNQETIINDYIASL |
Ga0207938_10120563 | 3300020525 | Freshwater | MIEVIQDLRGDYTYVESSYSNIIIVGNEVLNADVANEILIQETIINNYI |
Ga0207934_10374591 | 3300020561 | Freshwater | MITVFQEVRGAYTYVESTYLNIIKVGNEVLNADVTTEITAQETIINDYI |
Ga0208053_10167292 | 3300020575 | Freshwater | MIEVIQEVRGAYTYVESVYSNIIRVGNEVLNADVSAEITNQETIINDYIASL |
Ga0181351_10426702 | 3300022407 | Freshwater Lake | MIEVYQEVRGAYTYVESTYSNIIRVGNEVLNADVTTEITAQETIINNYI |
Ga0244775_106916132 | 3300024346 | Estuarine | MIEVIQEVRGAYTYVESSYLNIIRVGNEVLNADVTTEITAQETIINDYI |
Ga0244775_110556492 | 3300024346 | Estuarine | MIEVIQDLRGDYTYVESSYSNIIKVGNEVLNADVSTEITNQETIINNYI |
Ga0244775_110853622 | 3300024346 | Estuarine | FKLCVMIEVYQEVRGAYTYVESSYLNIIRVGNEVLNADVTTEITAQETIINNYI |
Ga0208784_11454372 | 3300025732 | Aqueous | MIEVIQEVRGAYTYVESSYSNIIKVGNEVLNADVSTEITNQETIINDYIASL |
Ga0209850_10016632 | 3300026931 | Sand | MIEVIQEVRGAYTYVESVYSNTIRVGNEVLNADVSTEITNQETIINDYIASL |
Ga0208923_10517552 | 3300027320 | Estuarine | MIEVFQEVRGAYTYVESSYLNIIRVGNEVLNADVTTEITAQETIINNYI |
Ga0208975_11521412 | 3300027659 | Freshwater Lentic | MIEVIQDLRGDYTYVETSYLNIIKVGNEVLNADVSTEITNQETIINNYI |
Ga0209190_100038714 | 3300027736 | Freshwater Lake | MITVYQEIRGAYTYVESSYLNVIKIGNEVLNANVTAEITAQETIINNYI |
Ga0209596_100070811 | 3300027754 | Freshwater Lake | MIEVYQEVRGAYTYVESTYLNIIRVGNEVLNADVTTEITAQETIINDYI |
Ga0209768_101937452 | 3300027772 | Freshwater Lake | MIEVYQEVRGAYTYVESTYLNIIRVGNEVLNADVTTEITAQETIINNYI |
Ga0209246_101004852 | 3300027785 | Freshwater Lake | MIEVIQEVRGAYTYVESTYLNIIRVGNEVLNADVTTEITAQETIINNYI |
Ga0209353_100119941 | 3300027798 | Freshwater Lake | EVYQEVRGAYTYVESTYLNIIRVGNEVLNADVTTEITAQETIINNYI |
Ga0209354_103092792 | 3300027808 | Freshwater Lake | MITVIQEIRGAYTYVESSYLNVIKIGNEVLNANVTAEITAQETIIKS |
Ga0209230_102411802 | 3300027836 | Freshwater And Sediment | MIEVYKEVRGAYTYVESSYSDIIRVGNEVLNAGVTTEITAQETIINNYI |
Ga0209820_11292231 | 3300027956 | Freshwater Sediment | MIEVIQEVRGSYTYVESSYSNLIKVGNEVLNTDVSAEILNQETIINDYIASL |
Ga0315902_100131328 | 3300032093 | Freshwater | MIEVIQEVRGSYTYVESSYSNIIKVGNEVLNANVSSEITAQETIINDYIASL |
Ga0334989_0050040_1473_1622 | 3300033984 | Freshwater | MIEVYQEVRGDYTYVESSYLNIIKVGNEVLNADVTAEITAQETIINDYI |
Ga0334989_0472370_138_287 | 3300033984 | Freshwater | MIEVYQEVRGAYTYVESSYSNIIKVGNEVLNADVATEITAQETIINDYI |
Ga0335003_0256861_397_546 | 3300033995 | Freshwater | MITVIQEIRGAYTYVESSYLNIIKVGNEVLNANVTAEITAQETIINNYI |
Ga0335003_0339532_253_402 | 3300033995 | Freshwater | MITVIQEIRGAYTYVESSYLNVIKVGNEVLNANVTAEITAQETIINNYI |
Ga0334998_0560399_61_210 | 3300034019 | Freshwater | MIEVITEVRGAYTYVESSYSNIIKVGNEVLNADVTAEITAQETIINDYI |
Ga0335024_0188933_168_326 | 3300034051 | Freshwater | MIEVIQEVRGAYTYVESVYSNIIRVGNEVLNANVSSEITAQETIINDYIASL |
Ga0335024_0550209_374_523 | 3300034051 | Freshwater | MIEVYQEVRGAYTYVESSYSNIIKVGNEVLNADVTAEITAQETIINDYI |
Ga0334995_0406721_529_678 | 3300034062 | Freshwater | MIDVYQEVRGDYTYVESSYLNIIKVGNEVLNADVTAEITAQETIINDYI |
Ga0335019_0403538_457_615 | 3300034066 | Freshwater | MIEVIQEVRGAYTYVESVYSNIIRVGNEVLNADVSTEITNQETIINDYIASL |
Ga0335022_0022603_1921_2070 | 3300034095 | Freshwater | MIEVIQEVRGAYTYVESSYLNIIKVGNEVLNSDVATEITAQETIINDYI |
Ga0335022_0152644_357_506 | 3300034095 | Freshwater | MITVITEVRGAYTYVESSYSNIIRIGNEVLNADVAAEIVIQETIINDYI |
Ga0335035_0001221_12276_12425 | 3300034105 | Freshwater | MIEVITEVRGAYTYVESIYLNIIRVGNEVLNADVTAEITAQETIINDYI |
Ga0335035_0661785_25_174 | 3300034105 | Freshwater | MIEVYQEVRGAYTYVESSYSNIIKVGNEVLNADVAAEITAQETIINDYI |
Ga0335036_0734539_406_564 | 3300034106 | Freshwater | MIEVIQEVRGASTYVESVYFNIIRVGNEVLNADVSTEITNQETIINDYIASL |
Ga0335037_0034354_1456_1605 | 3300034107 | Freshwater | MIEVIQEVRGAYTYVESSYSNIIKVGNEVLNADVTTEITAQETIINNYI |
Ga0335055_0205627_157_306 | 3300034110 | Freshwater | MIEVYQEVRGAYTYVESTYLNIIKVGNEVLNADVTAEITAQETIINDYI |
Ga0335068_0000495_16771_16929 | 3300034116 | Freshwater | MIEVIQEVRGSYTYVESSYSNIIKIGNEVLNADVSTEILNQETIINDYIASL |
Ga0335068_0125334_20_169 | 3300034116 | Freshwater | MITVITEVRGAYTYVESSYSNIIRIGNEVLNANVSAEIVIQETIINDYI |
Ga0335068_0580468_334_483 | 3300034116 | Freshwater | MITVITEVRGAYTYVESSYSNIIRVGNEVLNSNVTEEITIQENIINNYI |
Ga0335054_0411766_417_566 | 3300034119 | Freshwater | MIEVITEVRGAYTYVESSYSNIIRVGNEVLNADVTTEITAQETIINDYI |
Ga0335058_0184621_149_298 | 3300034121 | Freshwater | MIEVYQEVRGAYTYVESTYLNIIRVGNEVLNTDVTTEITAQETIINDYI |
⦗Top⦘ |