NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F103214

Metagenome / Metatranscriptome Family F103214

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103214
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 41 residues
Representative Sequence LEAGLGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA
Number of Associated Samples 89
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.01 %
% of genes from short scaffolds (< 2000 bps) 92.08 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.317 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(31.683 % of family members)
Environment Ontology (ENVO) Unclassified
(22.772 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.465 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 41.79%    β-sheet: 0.00%    Coil/Unstructured: 58.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF03023MurJ 22.77
PF13631Cytochrom_B_N_2 8.91
PF13635DUF4143 5.94
PF07690MFS_1 4.95
PF00583Acetyltransf_1 4.95
PF13673Acetyltransf_10 1.98
PF00144Beta-lactamase 1.98
PF08241Methyltransf_11 0.99
PF03109ABC1 0.99
PF00355Rieske 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG0534Na+-driven multidrug efflux pump, DinF/NorM/MATE familyDefense mechanisms [V] 22.77
COG0728Lipid II flippase MurJ/MviN (peptidoglycan biosynthesis)Cell wall/membrane/envelope biogenesis [M] 22.77
COG2244Membrane protein involved in the export of O-antigen and teichoic acidCell wall/membrane/envelope biogenesis [M] 22.77
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 1.98
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 1.98
COG2367Beta-lactamase class ADefense mechanisms [V] 1.98
COG0661Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB familySignal transduction mechanisms [T] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.32 %
UnclassifiedrootN/A31.68 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004080|Ga0062385_10456979Not Available778Open in IMG/M
3300005355|Ga0070671_101869914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii534Open in IMG/M
3300005434|Ga0070709_10945102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales683Open in IMG/M
3300005439|Ga0070711_100400161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1114Open in IMG/M
3300005454|Ga0066687_10605211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii651Open in IMG/M
3300005591|Ga0070761_10516307All Organisms → cellular organisms → Bacteria → Terrabacteria group738Open in IMG/M
3300006573|Ga0074055_11873491Not Available652Open in IMG/M
3300006804|Ga0079221_10140657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1248Open in IMG/M
3300006806|Ga0079220_11648853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii558Open in IMG/M
3300006806|Ga0079220_11789683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii541Open in IMG/M
3300006954|Ga0079219_10026913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2218Open in IMG/M
3300009520|Ga0116214_1078011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1211Open in IMG/M
3300009520|Ga0116214_1086333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1150Open in IMG/M
3300009551|Ga0105238_10236629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1803Open in IMG/M
3300009700|Ga0116217_10735049Not Available609Open in IMG/M
3300009700|Ga0116217_11007064Not Available510Open in IMG/M
3300010379|Ga0136449_101311421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1127Open in IMG/M
3300010379|Ga0136449_101972121Not Available864Open in IMG/M
3300010379|Ga0136449_101995744Not Available857Open in IMG/M
3300010396|Ga0134126_11932925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii646Open in IMG/M
3300010876|Ga0126361_10850359All Organisms → cellular organisms → Bacteria1666Open in IMG/M
3300011120|Ga0150983_14289911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1105Open in IMG/M
3300012208|Ga0137376_10573627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii977Open in IMG/M
3300012362|Ga0137361_10462634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1165Open in IMG/M
3300012397|Ga0134056_1005020Not Available575Open in IMG/M
3300012515|Ga0157338_1052971Not Available588Open in IMG/M
3300012977|Ga0134087_10391027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii675Open in IMG/M
3300012984|Ga0164309_10132429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1630Open in IMG/M
3300012989|Ga0164305_11377213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii620Open in IMG/M
3300012989|Ga0164305_12060170Not Available522Open in IMG/M
3300013296|Ga0157374_11747226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii647Open in IMG/M
3300013297|Ga0157378_12012958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii628Open in IMG/M
3300014166|Ga0134079_10329558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii688Open in IMG/M
3300016404|Ga0182037_11095629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii697Open in IMG/M
3300016445|Ga0182038_10435470Not Available1106Open in IMG/M
3300017932|Ga0187814_10244113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia680Open in IMG/M
3300017937|Ga0187809_10035009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura roseirufa1607Open in IMG/M
3300017959|Ga0187779_10822453Not Available635Open in IMG/M
3300017973|Ga0187780_10826776Not Available671Open in IMG/M
3300017999|Ga0187767_10360331Not Available514Open in IMG/M
3300018060|Ga0187765_10617234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura roseirufa702Open in IMG/M
3300018086|Ga0187769_11527393Not Available505Open in IMG/M
3300019786|Ga0182025_1324981Not Available2239Open in IMG/M
3300020582|Ga0210395_10203204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1486Open in IMG/M
3300021171|Ga0210405_10287065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1301Open in IMG/M
3300021405|Ga0210387_11581810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia558Open in IMG/M
3300021432|Ga0210384_11060844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria713Open in IMG/M
3300021474|Ga0210390_10132211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2096Open in IMG/M
3300021474|Ga0210390_10160122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1898Open in IMG/M
3300021474|Ga0210390_10491820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. HPF12051034Open in IMG/M
3300021474|Ga0210390_10515792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1006Open in IMG/M
3300021477|Ga0210398_10358937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1188Open in IMG/M
3300021477|Ga0210398_10394942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1128Open in IMG/M
3300021478|Ga0210402_10626252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana996Open in IMG/M
3300025905|Ga0207685_10096334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1257Open in IMG/M
3300025911|Ga0207654_10162770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1443Open in IMG/M
3300025928|Ga0207700_10033718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3666Open in IMG/M
3300025929|Ga0207664_11098008Not Available711Open in IMG/M
3300027096|Ga0208099_1046424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii622Open in IMG/M
3300027662|Ga0208565_1051368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1322Open in IMG/M
3300027750|Ga0209461_10152606All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300027765|Ga0209073_10260617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii677Open in IMG/M
3300027765|Ga0209073_10500285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii512Open in IMG/M
3300027857|Ga0209166_10033696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3095Open in IMG/M
3300028877|Ga0302235_10409971Not Available579Open in IMG/M
3300029999|Ga0311339_10919826Not Available828Open in IMG/M
3300030503|Ga0311370_10366116Not Available1829Open in IMG/M
3300030617|Ga0311356_10525065Not Available1154Open in IMG/M
3300030743|Ga0265461_11175916Not Available787Open in IMG/M
3300031090|Ga0265760_10273147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia592Open in IMG/M
3300031236|Ga0302324_101154464Not Available1036Open in IMG/M
3300031544|Ga0318534_10428771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii758Open in IMG/M
3300031549|Ga0318571_10234777Not Available669Open in IMG/M
3300031564|Ga0318573_10514879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii644Open in IMG/M
3300031680|Ga0318574_10346368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii866Open in IMG/M
3300031708|Ga0310686_105253210Not Available516Open in IMG/M
3300031708|Ga0310686_107511644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales7765Open in IMG/M
3300031715|Ga0307476_10789259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii702Open in IMG/M
3300031720|Ga0307469_10462810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1101Open in IMG/M
3300031747|Ga0318502_10539012Not Available700Open in IMG/M
3300031765|Ga0318554_10492866Not Available693Open in IMG/M
3300031770|Ga0318521_10135288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1389Open in IMG/M
3300031771|Ga0318546_10343187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1038Open in IMG/M
3300031777|Ga0318543_10315422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia699Open in IMG/M
3300031778|Ga0318498_10195044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii919Open in IMG/M
3300031819|Ga0318568_10479466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria776Open in IMG/M
3300031846|Ga0318512_10684419Not Available525Open in IMG/M
3300031859|Ga0318527_10417618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii572Open in IMG/M
3300031860|Ga0318495_10033099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2260Open in IMG/M
3300031897|Ga0318520_10107293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1575Open in IMG/M
3300032001|Ga0306922_11015573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii855Open in IMG/M
3300032009|Ga0318563_10666358Not Available559Open in IMG/M
3300032010|Ga0318569_10237886All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300032042|Ga0318545_10265098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii617Open in IMG/M
3300032044|Ga0318558_10530040Not Available588Open in IMG/M
3300032054|Ga0318570_10317679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii708Open in IMG/M
3300032160|Ga0311301_10179408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3707Open in IMG/M
3300032782|Ga0335082_11605851Not Available523Open in IMG/M
3300032828|Ga0335080_10842748Not Available944Open in IMG/M
3300032954|Ga0335083_10209350Not Available1776Open in IMG/M
3300033134|Ga0335073_10331225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1812Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil31.68%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.94%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.95%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.95%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.97%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.98%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.98%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.98%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.99%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.99%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.99%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.99%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.99%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.99%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012397Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027096Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062385_1045697913300004080Bog Forest SoilNGFANDSALQAGLTVATSVIMGVIVTGVALAVAVNLLSSFTLKGEPA*
Ga0070671_10186991413300005355Switchgrass RhizosphereALQAGLNVLTSVVMGIIVTAAALLLAASLLSSFTIQGEPA*
Ga0070709_1094510213300005434Corn, Switchgrass And Miscanthus RhizosphereNGLASDPVLEAGLGVLTSVVMGAIVTVVALAVAMNLLSSFTLKGEPA*
Ga0070711_10040016123300005439Corn, Switchgrass And Miscanthus RhizosphereTDPALQAGLGVLTSVVMGIIVTAAALLLAVSLLSSFTLKGEPA*
Ga0066687_1060521113300005454SoilLEAGLGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA*
Ga0070761_1051630713300005591SoilDTALNAGLNVTTSVVMGAIVTVIALVLAVRLLSSFTLKGEPT*
Ga0074055_1187349113300006573SoilEAGLGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA*
Ga0079221_1014065713300006804Agricultural SoilAGLGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA*
Ga0079220_1164885323300006806Agricultural SoilDPALQAGLNVLTSVVMGIIVTAAALLLAASLLSSFTIQGEPA*
Ga0079220_1178968323300006806Agricultural SoilAGLGVLTSVVMGAIVTAVALALAMNLLSSFTLKGEPA*
Ga0079219_1002691333300006954Agricultural SoilDPALEAGLGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA*
Ga0116214_107801123300009520Peatlands SoilNDPDLQAGLTVATSVVMGVIVTGLALVLAVNLLSSFTLKGEPA*
Ga0116214_108633313300009520Peatlands SoilNAIAHDSSLMAGLNPATAIIMGSIVTVGALVLAINLLSGFTLKGEPA*
Ga0105238_1023662913300009551Corn RhizosphereNDPLLEAGLGVLTSVVMGAIVTAVALALAMNLLSSFTLKGEPA*
Ga0116217_1073504913300009700Peatlands SoilLQAGLTVTTSVVMGVIVTGLALALAVNLLSSFTLKGEPA*
Ga0116217_1100706423300009700Peatlands SoilGFVNDTALQAGLTVTTSVVMGVIVTGLALALAVNLLSSFTLKGEPA*
Ga0136449_10131142123300010379Peatlands SoilTVATSVVMGVIVTGVALAVAVNLLSSFTLKGEPA*
Ga0136449_10197212113300010379Peatlands SoilPALQAGLTVTTAVVMGVIVTGLALALAVNLLSSFTLKGEPA*
Ga0136449_10199574423300010379Peatlands SoilGLTVATSVIMGVIVTGVALAVAVNLLSSFTLKGEPA*
Ga0134126_1193292523300010396Terrestrial SoilPVLEAGLGVLTSVVMGAIVTVVALALAMNLLSSFSMKGEPA*
Ga0126361_1085035933300010876Boreal Forest SoilGLGVPTSVVMGAIVTVAALAVAVNLLSSFTLKGDPA*
Ga0150983_1428991123300011120Forest SoilSALAAGLTVTTSVVMGVIVTGIALALAVNLLSSFTLKGEPA*
Ga0137376_1057362723300012208Vadose Zone SoilGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA*
Ga0137361_1046263413300012362Vadose Zone SoilPVLEAGLGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA*
Ga0134056_100502023300012397Grasslands SoilALEAGLGVLTSVVMGAIVTVAALALAMNLLSSFTLKGEPA*
Ga0157338_105297113300012515Arabidopsis RhizosphereNGLASDPALEAGLGVLTSIVMGAIVTVAALALAMNLLSSFTLKGEPA*
Ga0134087_1039102723300012977Grasslands SoilGLLTSVVMGAIVTAVALALGMNLLSSFTLKGEPA*
Ga0164309_1013242913300012984SoilNDPVLEAGLGVLTSVVMGAIVTAVALALAMNLLSSFTLKGEPA*
Ga0164305_1137721313300012989SoilSGFVADPALQAGLNVLTSVVMGIIVTAAALLLAASLLSSFTIQGEPA*
Ga0164305_1206017013300012989SoilAGLGVLTSVVMGAIVSVVALALAMNLLSSFTLKGEPA*
Ga0157374_1174722613300013296Miscanthus RhizosphereLNVLTSVVMGIIVTAAALLLAASLLSSFTIQGEPA*
Ga0157378_1201295823300013297Miscanthus RhizosphereEAGLGVLTSVVMGAIVTVVALALAMNLLSSFSLKGEPA*
Ga0134079_1032955823300014166Grasslands SoilEAGLGLLTSVVMGAIVTAVALALGMNLLSSFTLKGEPA*
Ga0182037_1109562923300016404SoilLSVAVSIVMGAIVTVLALVLAINLLSSFTLKGEPA
Ga0182038_1043547013300016445SoilPVLEAGLGVLTSVVMGAIVTVAALVLAVNLLSSFTLKGEPA
Ga0187814_1024411323300017932Freshwater SedimentAGIAVPTAIIMGAIVTVGALALAINLLSGFTLKGEPA
Ga0187809_1003500943300017937Freshwater SedimentLTVTVSIVMGAIVTVVALLLAINLLSSFTLKGEPA
Ga0187779_1082245313300017959Tropical PeatlandIAHDSSLNAGLTVTVSVVMGAIVTVAALLLAVNLLSSFTLKGEPA
Ga0187780_1082677613300017973Tropical PeatlandAGLTPSTSVVMGGIVTAAALVLAVNLLSSFTLEGEPA
Ga0187767_1036033123300017999Tropical PeatlandAHDATLNAGLTVTVSVVMGAIVTVAALALAINLLSAFTLKGEPA
Ga0187765_1061723423300018060Tropical PeatlandGLTVTVSVVMGAIVTVAALLLAVNLLSSFTIKGEPA
Ga0187769_1152739313300018086Tropical PeatlandALQAGLGVATSVVMGVIVTAVALALAVNLLSSFTLKGEPA
Ga0182025_132498153300019786PermafrostGFAHDPSLSAGLTVLTSVIMGAVVTVAALALAVNLLSSFTLKGEPA
Ga0210395_1020320433300020582SoilEAGLGVVTSVIMGAIVTAVALALAMNLLSSFTLKGEPA
Ga0210405_1028706513300021171SoilDSTLNAGLSVATSVVMGVIVTVAALVLAVNLLSSFTLKGEPA
Ga0210387_1158181013300021405SoilGTLNAGLSVATSVVMGVIVTVAALVLAVNLLSSFTLKGEPA
Ga0210384_1106084413300021432SoilHDSSLNAGLTVGVCIAMGAIVTVGALILAIRLLSSFTLKGEPA
Ga0210390_1013221113300021474SoilTLNAGLSVATSVVMGVIVTVAALVLAVNLLSSFTLKGEPA
Ga0210390_1016012213300021474SoilNGIAHDTTLNAGLSVATSVVMGVIVTVAALILAVRLLSSFTLKGEPA
Ga0210390_1049182023300021474SoilLLQAGLSALTSVIMGVIVTVGALVLAVNLLSGFTIKGEPA
Ga0210390_1051579213300021474SoilAGLTVVTSVVMGIIVTALALALAVNLLSSFTLKGEPA
Ga0210398_1035893713300021477SoilAHDSSLNAGLSVATSVVMGAIVTVAALVLAVNLLSSFTLKGEPA
Ga0210398_1039494213300021477SoilGIANGFINDSLLQAGLSLATSVVLGAIVTVGALVLAVRLLSGFTIKGEPA
Ga0210402_1062625233300021478SoilVLEAGLGLLTSVVMGAIVTTVALALATNLLSSFTLKGEPA
Ga0207685_1009633423300025905Corn, Switchgrass And Miscanthus RhizosphereEAGLGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA
Ga0207654_1016277033300025911Corn RhizosphereLGVLTSVVMGAIVTAVALALAMNLLSSFTLKGEPA
Ga0207700_1003371813300025928Corn, Switchgrass And Miscanthus RhizosphereLEAGLGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA
Ga0207664_1109800823300025929Agricultural SoilAGLGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA
Ga0208099_104642413300027096Forest SoilLNAGLSVATSVVMGVIVTVAALVLAVNLLSSFTLKGEPA
Ga0208565_105136823300027662Peatlands SoilLQAGLTVTTSVVMGVIVTGLALALAVNLLSSFTLKGEPA
Ga0209461_1015260613300027750AgaveSDPALEAGLGLLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA
Ga0209073_1026061723300027765Agricultural SoilGLNVLTSVVMGIIVTAAALLLAASLLSSFTIQGEPA
Ga0209073_1050028513300027765Agricultural SoilGFVADPALQAGLNVLTSVVMGIIVTAAALLLAASLLSSFTIQGEPA
Ga0209166_1003369643300027857Surface SoilSLNAGLSTATSVVMGVIVTVAALVLAVRLLSGFTLKGEPA
Ga0302235_1040997113300028877PalsaLAAGLSVPTSVIMGAVVTVAALALAVNLLSSFTLKGEPA
Ga0311339_1091982613300029999PalsaGLSVPTSVIMGAVVTVAALALAVNLLSSFTLKGEPA
Ga0311370_1036611613300030503PalsaWIAHDSSLNAGLSVATSVVMGIIVTVAALVLAVNLLSSFTLKGEPA
Ga0311356_1052506523300030617PalsaAHDPALGAGLTTGTSVVMGAIVTVVALVLAVKLLTSFTLEGDPA
Ga0265461_1117591623300030743SoilAHDPSLDAGLAVPTSVIMGAVVTVAALALAVNLLSSYTLKGEPA
Ga0265760_1027314713300031090SoilGIAHDSSLNAGLSIATSVVMGAIVTVAALVLAVRLLSGFTLKGEPA
Ga0302324_10115446413300031236PalsaHDPSLAAGLTVLTSVIMGALVTVAALALAVNLLSSFTLKGEPA
Ga0318534_1042877113300031544SoilSSLDAGLTVTVSIVMGAIVTVAALLLAVNLLSSFTLKGEPA
Ga0318571_1023477723300031549SoilGIAHDASLNAGLTVTVSVVMGAIVTVAALILAVNLLSGFTLKGEPA
Ga0318573_1051487913300031564SoilAHDTSLNAGLSVAVSIVMGAIVTVLALVLAINLLSSFTLKGEPA
Ga0318574_1034636813300031680SoilLTATVSIVMGAIVTVLALVLAINLLSSFTLKGEPA
Ga0310686_10525321023300031708SoilGLSVSTSVIMGAIFTVLALVLAVRLLSAFTLKGDPA
Ga0310686_10751164493300031708SoilAGLSVPTSIIMGAIFTVLALVLAVRLLSGFTLKGDPA
Ga0307476_1078925913300031715Hardwood Forest SoilIAHDSTLNAGLSVATSVVMGVIVTVAALVLAVRLLSSFTLKGEPA
Ga0307469_1046281013300031720Hardwood Forest SoilEAGLGVLTSVVMGAIVTVVALALAMNLLSSFSLKGEPA
Ga0318502_1053901213300031747SoilILNDPVLEAGLGVLTSVVMGAIVTVAALVLAVKLLSSFTLKGEPA
Ga0318554_1049286613300031765SoilILNDPVLEAGLGVLTSVVMGAIVTVAALVLAVNLLSSFTLKGEPA
Ga0318521_1013528813300031770SoilDTSLNAGLSVAVSIVMGAIVTVLALVLAINLLSSFTLKGEPA
Ga0318546_1034318723300031771SoilGIVNDPVLEAGLGVLTSVLMGAIVTAAALALAMNLLSSFTLKGEPA
Ga0318543_1031542213300031777SoilHDSSLDAGLTVTVSIVMGAIVTVAALLLAVNLLSSFTLKGEPA
Ga0318498_1019504413300031778SoilNGIVNDPVLEAGLGVLTSVLMGAIVTAAALALAMNLLSSFTLKGEPA
Ga0318568_1047946623300031819SoilAHDSTLDAGLTATVSIVMGAIVTVLALVLAINLLSSFTLKGEPA
Ga0318512_1068441923300031846SoilTSLNAGLSVAVSIVMGAIVTVLALVLAINLLSSFTLKGEPA
Ga0318527_1041761813300031859SoilNDPVLEAGLGVLTSVLMGAIVTAAALALAMNLLSSFTLKGEPA
Ga0318495_1003309913300031860SoilSSLNAGLSVAVSIVMGAIVTVLALVLAINLLSSFTLKGEPA
Ga0318520_1010729313300031897SoilGLSVAVSIVMGAIVTVLALVLAINLLSSFTLKGEPA
Ga0306922_1101557313300032001SoilGIAHDSSLDAGLTVTVSIVMGAIVTVAALLLAVNLLSSFTLKGEPA
Ga0318563_1066635813300032009SoilLGVLTSVVMGAIVTVAALVLAVNLLSSFTLKGEPA
Ga0318569_1023788613300032010SoilANAIAHDSTLDAGLTATVSIVMGAIVTVLALVLAINLLSSFTLKGEPA
Ga0318545_1026509813300032042SoilDSSLNAGLSVAVSIVMGAIVTVLALVLAINLLSSFTLKGEPA
Ga0318558_1053004013300032044SoilSLDAGLTVTVSIVMGAIVTVAALLLAVNLLSSFTLKGEPA
Ga0318570_1031767913300032054SoilAYGIAHDSSLNAGLSVAVSIVMGAIVTVLALVLAINLLSSFTLKGEPA
Ga0311301_1017940843300032160Peatlands SoilDTALQAGLTMTTSVVMGVIVTGLALALAVNLLSSFTLKGEPA
Ga0335082_1160585123300032782SoilEAGLGVLTSVVMGAIVTAVALALAMNLLSSFALKGEPA
Ga0335080_1084274823300032828SoilGVLTSVVMGAIVTAVALVLAVNLLSSFTLKGEPAL
Ga0335083_1020935013300032954SoilLEAGLGVLTSVVMGTIVTVVALALAMNLLSSFTLKGEPA
Ga0335073_1033122513300033134SoilLQAGLNVLTSAGMGIIVTATALLLAASLLSSFTIQGEPA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.