| Basic Information | |
|---|---|
| Family ID | F103197 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MATIIFGLVVLALVLWALNAFTKVNPQTAAVVLKTGGGLGALA |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.01 % |
| % of genes from short scaffolds (< 2000 bps) | 85.15 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.337 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.822 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.743 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.485 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 49.30% β-sheet: 0.00% Coil/Unstructured: 50.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF02569 | Pantoate_ligase | 14.85 |
| PF13519 | VWA_2 | 13.86 |
| PF13458 | Peripla_BP_6 | 1.98 |
| PF09140 | MipZ | 1.98 |
| PF07370 | DUF1489 | 0.99 |
| PF00892 | EamA | 0.99 |
| PF01131 | Topoisom_bac | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0414 | Panthothenate synthetase | Coenzyme transport and metabolism [H] | 14.85 |
| COG1192 | ParA-like ATPase involved in chromosome/plasmid partitioning or cellulose biosynthesis protein BcsQ | Cell cycle control, cell division, chromosome partitioning [D] | 1.98 |
| COG0550 | DNA topoisomerase IA | Replication, recombination and repair [L] | 0.99 |
| COG1110 | Reverse gyrase | Replication, recombination and repair [L] | 0.99 |
| COG5458 | Uncharacterized conserved protein, DUF1489 domain | Function unknown [S] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.34 % |
| All Organisms | root | All Organisms | 33.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000655|AF_2010_repII_A100DRAFT_1060738 | Not Available | 670 | Open in IMG/M |
| 3300001661|JGI12053J15887_10416374 | Not Available | 645 | Open in IMG/M |
| 3300002075|JGI24738J21930_10130466 | Not Available | 550 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101397431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 593 | Open in IMG/M |
| 3300005168|Ga0066809_10047967 | Not Available | 951 | Open in IMG/M |
| 3300005329|Ga0070683_101838252 | Not Available | 582 | Open in IMG/M |
| 3300005332|Ga0066388_107021432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
| 3300005363|Ga0008090_10213197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1297 | Open in IMG/M |
| 3300005363|Ga0008090_10223657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300005367|Ga0070667_100597055 | Not Available | 1017 | Open in IMG/M |
| 3300005444|Ga0070694_100194154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1509 | Open in IMG/M |
| 3300005549|Ga0070704_101525021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 615 | Open in IMG/M |
| 3300005552|Ga0066701_10047201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2346 | Open in IMG/M |
| 3300005713|Ga0066905_100029040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3103 | Open in IMG/M |
| 3300005713|Ga0066905_101979282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 540 | Open in IMG/M |
| 3300005981|Ga0081538_10038437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3087 | Open in IMG/M |
| 3300006038|Ga0075365_10693872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 719 | Open in IMG/M |
| 3300006038|Ga0075365_10972826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300006580|Ga0074049_13167724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 608 | Open in IMG/M |
| 3300006853|Ga0075420_100947001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 741 | Open in IMG/M |
| 3300009012|Ga0066710_102056086 | Not Available | 843 | Open in IMG/M |
| 3300009088|Ga0099830_10053706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2853 | Open in IMG/M |
| 3300009090|Ga0099827_10830748 | Not Available | 800 | Open in IMG/M |
| 3300009101|Ga0105247_11005860 | Not Available | 651 | Open in IMG/M |
| 3300009137|Ga0066709_103066125 | Not Available | 612 | Open in IMG/M |
| 3300009137|Ga0066709_104211293 | Not Available | 524 | Open in IMG/M |
| 3300009147|Ga0114129_11370126 | Not Available | 874 | Open in IMG/M |
| 3300009156|Ga0111538_10282328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2102 | Open in IMG/M |
| 3300009792|Ga0126374_10115981 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
| 3300010046|Ga0126384_11527798 | Not Available | 626 | Open in IMG/M |
| 3300010048|Ga0126373_10697235 | Not Available | 1073 | Open in IMG/M |
| 3300010360|Ga0126372_12551836 | Not Available | 562 | Open in IMG/M |
| 3300010375|Ga0105239_10264463 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
| 3300010398|Ga0126383_11095732 | Not Available | 886 | Open in IMG/M |
| 3300012204|Ga0137374_10023000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 7011 | Open in IMG/M |
| 3300012376|Ga0134032_1156278 | Not Available | 863 | Open in IMG/M |
| 3300012914|Ga0157297_10363769 | Not Available | 567 | Open in IMG/M |
| 3300012951|Ga0164300_11141506 | Not Available | 512 | Open in IMG/M |
| 3300012972|Ga0134077_10536514 | Not Available | 522 | Open in IMG/M |
| 3300012988|Ga0164306_10334806 | Not Available | 1116 | Open in IMG/M |
| 3300014150|Ga0134081_10018573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1939 | Open in IMG/M |
| 3300014317|Ga0075343_1002923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2348 | Open in IMG/M |
| 3300014745|Ga0157377_10998796 | Not Available | 633 | Open in IMG/M |
| 3300015264|Ga0137403_10779739 | Not Available | 812 | Open in IMG/M |
| 3300015374|Ga0132255_103537519 | Not Available | 664 | Open in IMG/M |
| 3300016294|Ga0182041_10541684 | Not Available | 1015 | Open in IMG/M |
| 3300016319|Ga0182033_10010382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5228 | Open in IMG/M |
| 3300016341|Ga0182035_10057963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2664 | Open in IMG/M |
| 3300016357|Ga0182032_10056868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2570 | Open in IMG/M |
| 3300016387|Ga0182040_10955595 | Not Available | 713 | Open in IMG/M |
| 3300018469|Ga0190270_12189817 | Not Available | 613 | Open in IMG/M |
| 3300020580|Ga0210403_11523104 | Not Available | 502 | Open in IMG/M |
| 3300021951|Ga0222624_1326402 | Not Available | 970 | Open in IMG/M |
| 3300025900|Ga0207710_10548369 | Not Available | 602 | Open in IMG/M |
| 3300025910|Ga0207684_10883097 | Not Available | 752 | Open in IMG/M |
| 3300025915|Ga0207693_10109975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2161 | Open in IMG/M |
| 3300025940|Ga0207691_11523933 | Not Available | 546 | Open in IMG/M |
| 3300026095|Ga0207676_10851318 | Not Available | 892 | Open in IMG/M |
| 3300027014|Ga0207815_1045546 | Not Available | 528 | Open in IMG/M |
| 3300027063|Ga0207762_1030849 | Not Available | 819 | Open in IMG/M |
| 3300027388|Ga0208995_1031202 | Not Available | 932 | Open in IMG/M |
| 3300027521|Ga0209524_1020739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1357 | Open in IMG/M |
| 3300027583|Ga0209527_1125955 | Not Available | 571 | Open in IMG/M |
| 3300027605|Ga0209329_1108527 | Not Available | 609 | Open in IMG/M |
| 3300028379|Ga0268266_11070290 | Not Available | 780 | Open in IMG/M |
| 3300028381|Ga0268264_12102084 | Not Available | 573 | Open in IMG/M |
| 3300028536|Ga0137415_10539389 | Not Available | 976 | Open in IMG/M |
| 3300028721|Ga0307315_10097673 | Not Available | 861 | Open in IMG/M |
| 3300028754|Ga0307297_10015343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2093 | Open in IMG/M |
| 3300028768|Ga0307280_10156749 | Not Available | 788 | Open in IMG/M |
| 3300028771|Ga0307320_10156137 | Not Available | 883 | Open in IMG/M |
| 3300028782|Ga0307306_10041343 | Not Available | 1125 | Open in IMG/M |
| 3300028793|Ga0307299_10266367 | Not Available | 644 | Open in IMG/M |
| 3300028796|Ga0307287_10009789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3192 | Open in IMG/M |
| 3300028799|Ga0307284_10234922 | Not Available | 726 | Open in IMG/M |
| 3300028802|Ga0307503_10012879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2536 | Open in IMG/M |
| 3300028810|Ga0307294_10056899 | Not Available | 1151 | Open in IMG/M |
| 3300028906|Ga0308309_10639171 | Not Available | 924 | Open in IMG/M |
| 3300031170|Ga0307498_10379559 | Not Available | 550 | Open in IMG/M |
| 3300031545|Ga0318541_10753170 | Not Available | 543 | Open in IMG/M |
| 3300031549|Ga0318571_10037795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1381 | Open in IMG/M |
| 3300031561|Ga0318528_10604429 | Not Available | 588 | Open in IMG/M |
| 3300031564|Ga0318573_10640482 | Not Available | 572 | Open in IMG/M |
| 3300031640|Ga0318555_10196303 | Not Available | 1087 | Open in IMG/M |
| 3300031751|Ga0318494_10555502 | Not Available | 670 | Open in IMG/M |
| 3300031765|Ga0318554_10127280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1440 | Open in IMG/M |
| 3300031770|Ga0318521_10011019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3888 | Open in IMG/M |
| 3300031781|Ga0318547_10652185 | Not Available | 654 | Open in IMG/M |
| 3300031781|Ga0318547_11012234 | Not Available | 519 | Open in IMG/M |
| 3300031846|Ga0318512_10555479 | Not Available | 584 | Open in IMG/M |
| 3300031846|Ga0318512_10673459 | Not Available | 529 | Open in IMG/M |
| 3300031890|Ga0306925_10367907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1543 | Open in IMG/M |
| 3300031890|Ga0306925_10942624 | Not Available | 884 | Open in IMG/M |
| 3300032001|Ga0306922_11385227 | Not Available | 708 | Open in IMG/M |
| 3300032025|Ga0318507_10131755 | Not Available | 1060 | Open in IMG/M |
| 3300032060|Ga0318505_10067823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1566 | Open in IMG/M |
| 3300032063|Ga0318504_10318504 | Not Available | 737 | Open in IMG/M |
| 3300032068|Ga0318553_10489590 | Not Available | 644 | Open in IMG/M |
| 3300032174|Ga0307470_10836832 | Not Available | 717 | Open in IMG/M |
| 3300032261|Ga0306920_103087939 | Not Available | 626 | Open in IMG/M |
| 3300033290|Ga0318519_10686463 | Not Available | 625 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.98% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.99% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.99% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A100DRAFT_10607381 | 3300000655 | Forest Soil | MATIIFGLVVLALVLWALNAFTKVNPQTAAVVLKTGGGLGALAAAGLLGV |
| JGI12053J15887_104163742 | 3300001661 | Forest Soil | MALIFGLVLLALLLWALHAFTKVKPQTAAVVLKTGGGLG |
| JGI24738J21930_101304662 | 3300002075 | Corn Rhizosphere | MALIFGLVLLALLLWALHAFTKIKPQTAAVALKTGGGLG |
| JGIcombinedJ26739_1013974312 | 3300002245 | Forest Soil | MATIIFGLVVLALVLWALNAFTKVNPQTAAVVLKTGGGLGAL |
| Ga0066809_100479671 | 3300005168 | Soil | MTLIFGLVLLALLLWALHAFTKVKPQTAAVVLKTGGGLGA |
| Ga0070683_1018382522 | 3300005329 | Corn Rhizosphere | MALIFGLVLLALLLWALHAFTKIKPQTAAVALKTGGGLGA |
| Ga0066388_1070214322 | 3300005332 | Tropical Forest Soil | MATIIFGLVVLALVLWALNAFTKVNPQTAAVVLKTGGGLGALA |
| Ga0008090_102131973 | 3300005363 | Tropical Rainforest Soil | MATIIFGLVVLALVLWALNAFTKVNPQTAAVVLKTGGGLGALAAAG |
| Ga0008090_102236572 | 3300005363 | Tropical Rainforest Soil | MAQIIFGLVVLALVLWALNAFTKVNPQTAAVVLKTGGGLGALAAAGLL |
| Ga0070667_1005970552 | 3300005367 | Switchgrass Rhizosphere | MALIFGLVLLALLLWALHAFTKIKPQTAAVALKTGGGLGAL |
| Ga0070694_1001941543 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLIFGLVLLALLLWALHAFTKDKPQTAAVVLKTGGGLGAIAVA |
| Ga0070704_1015250211 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLIFGLVLLALLLWALHAFTKVKPQTAAVVLKTGGGLGAIAVAGLL |
| Ga0066701_100472011 | 3300005552 | Soil | MATIVFGLVVLALLLWALNAFTKVNPQTAAVMLKTGGGLGALAVA |
| Ga0066905_1000290406 | 3300005713 | Tropical Forest Soil | MATVLFGIVVLALVLVALNTFTKVNPHTAAVVLKTGGG |
| Ga0066905_1019792822 | 3300005713 | Tropical Forest Soil | MATIIFGLVILALALWALNAFTKVNPQTAAAVLKAGGGIGAL |
| Ga0081538_100384375 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MATLIFGLVILALALWALNAFTKVNPQTAAVVLKT |
| Ga0075365_106938721 | 3300006038 | Populus Endosphere | MALIFGLVVLALVLWALHAFTQVKPQTAAVVLKTGGGLGAIAIAGLLGARGRLD |
| Ga0075365_109728261 | 3300006038 | Populus Endosphere | MATILFGLVVLALVLWALNSFTKVNPQTAAVVLKTGGGL |
| Ga0074049_131677242 | 3300006580 | Soil | MASLIFGVLVLALALWALNAFTKVNPHTAAAVLKAGGGL |
| Ga0075420_1009470011 | 3300006853 | Populus Rhizosphere | MAAILFGIVVLALGLWALSAFTRLKPHTAAVVLKTGGGVGALALAG |
| Ga0066710_1020560862 | 3300009012 | Grasslands Soil | MATLIFGLVVLALLLWAFSAFTKISPQTAAVVVKT |
| Ga0099830_100537061 | 3300009088 | Vadose Zone Soil | MASLIFGLVVLALALWALNAFTKVTPQTAAAVLKAGGGLGAL |
| Ga0099827_108307482 | 3300009090 | Vadose Zone Soil | MAMLLFGLVVLALAMWALNALTKISPQKAAVVLKTGGG |
| Ga0105247_110058601 | 3300009101 | Switchgrass Rhizosphere | MASLLFGVVVLALALWALNAFTKVSPHRAAVALKTSGGLGALALAGVLGIRGR |
| Ga0066709_1030661251 | 3300009137 | Grasslands Soil | MATLLFGLVVLALLLYALNAFSKVNPHTAAVVLKTGGGIGALAIAG |
| Ga0066709_1042112931 | 3300009137 | Grasslands Soil | MATIVFGLVVLALVLWALNAFTKVNPQTAAVVLKT |
| Ga0114129_113701261 | 3300009147 | Populus Rhizosphere | MATIIFGLVVLALALWTLNAFTKVNPQTVAVVLKTGGGLGALAV |
| Ga0111538_102823281 | 3300009156 | Populus Rhizosphere | MALIFGVVLLALLLWALHAFTKIKPQTAAVVLKTGGGL |
| Ga0126374_101159813 | 3300009792 | Tropical Forest Soil | MATVIFGLVVLALLLWALNAFTKVKPQTAAVVLKTGGGLGALA |
| Ga0126384_115277981 | 3300010046 | Tropical Forest Soil | MATLLFGLVVLALALWALNAFTRVNPHTAATAIKTGGGLGALALAGVLGVRGRL |
| Ga0126373_106972352 | 3300010048 | Tropical Forest Soil | MATIIFGLVVLALALWALNAFTKVNPQTAAVVLKTGGGLGALAAAG |
| Ga0126372_125518362 | 3300010360 | Tropical Forest Soil | MATIIFGLVVLALVLWALNAFTKVNPQTAAVVLKT |
| Ga0105239_102644633 | 3300010375 | Corn Rhizosphere | MALIFGLVLLALLLWALHAFTKIKPQTAAVALKTGGGLGALAVAGLLLAGP |
| Ga0126383_110957321 | 3300010398 | Tropical Forest Soil | MATILFGLVVLALVLWALNAFTKVNPQTAAVVLKTG |
| Ga0137374_1002300010 | 3300012204 | Vadose Zone Soil | MATIIFGLVVLALVLWALNAFTKVNPQTAAVVLKTGGGLGALAAAGLLGVR |
| Ga0134032_11562782 | 3300012376 | Grasslands Soil | MATIVFGLVVLALVLWALNAFTKVNPQTAAVMLKTGGGLGALAV |
| Ga0157297_103637692 | 3300012914 | Soil | MTLIFGLVLLALLLWALHAFTKVKPQTAAVVLKTG |
| Ga0164300_111415062 | 3300012951 | Soil | MALIFGLVLLALLLWALHAFTKVKPQTAAVVLKTGGGLGAIAVA |
| Ga0134077_105365141 | 3300012972 | Grasslands Soil | MATILFGLVVLALVLWAFNAFTKTNPQTAAVVLKTGGGLGALAV |
| Ga0164306_103348061 | 3300012988 | Soil | MALIFGLVLLALLLWALHAFTKIKPQTAAVALKTGGG |
| Ga0134081_100185733 | 3300014150 | Grasslands Soil | MATIVFGLVVLALLLWALNAFTKVNPQTAAVMLKTGGGL |
| Ga0075343_10029231 | 3300014317 | Natural And Restored Wetlands | MALIFGLVVLALLLWALHSFSQANPRTMAIVFKTGGGVGALA |
| Ga0157377_109987961 | 3300014745 | Miscanthus Rhizosphere | MALIFGLVLLALLLWALHAFTKIKPQTAAVALKTGG |
| Ga0137403_107797392 | 3300015264 | Vadose Zone Soil | MASLLFGVVVLALALWALNAFTKVNPHTAAAVLKAGGGLGALAVAGVKLVGERLPLD* |
| Ga0132255_1035375191 | 3300015374 | Arabidopsis Rhizosphere | MAFIFGLVLLALLLWALHAFTQVKPQTAAVVLKTGG |
| Ga0182041_105416841 | 3300016294 | Soil | MGSLIVGLVVLALGLLALNAFTKVSPHKAAAVLKAGGGLGALAL |
| Ga0182033_100103821 | 3300016319 | Soil | MATVIFGLVVLALLLWALNAFTKVKPQTAAVVLKTGGGLGALAVAGVLGVRGRL |
| Ga0182035_100579634 | 3300016341 | Soil | MATIIFGLVVLALALWALNAFTKVNPQTAAVVLKTGGGLGALAAAGLLGVR |
| Ga0182032_100568684 | 3300016357 | Soil | MATIIFGLVVLALALWALNAFTKVNPQTAAVVLKTGGGLGA |
| Ga0182040_109555952 | 3300016387 | Soil | MATIVFGLVVLALALWALNAFTKVNPQTAAVVLKTGGGLGALAAAGLLGVRGRL |
| Ga0190270_121898171 | 3300018469 | Soil | MALIFGLVVLALLLWALHAFTKVKPQTAAVVLKTGGGLGALAVAGLLGAR |
| Ga0210403_115231041 | 3300020580 | Soil | MASLIFGVLVLALALWALNAFTKVNPHTAAAVLKAGGGLGALA |
| Ga0222624_13264021 | 3300021951 | Groundwater Sediment | MALIFGLVLLALLLWALHAFTKVKPQTAAVVLKTGGGLGALAVAGL |
| Ga0207710_105483692 | 3300025900 | Switchgrass Rhizosphere | MASLLFGVVVLALALWALNAFTKVSPHRAAVALKTSG |
| Ga0207684_108830972 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MATVVFGLVVLALLLWALNAFTKVNPQTAAVVLKTGGGLGAL |
| Ga0207693_101099751 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MATILFGLVVLALALWALNAFTKVNPQTAAIVLKTGGGLGALAVAGVLG |
| Ga0207691_115239332 | 3300025940 | Miscanthus Rhizosphere | MTLIFGLVVLALLLWALHAFTKVKPQTAAVVLKTGGGL |
| Ga0207676_108513181 | 3300026095 | Switchgrass Rhizosphere | MASLLFGVVVLALALWALNAFTKVSPHRAAVALKTSGG |
| Ga0207815_10455462 | 3300027014 | Tropical Forest Soil | MGALIFGLVALALGLVALNAFTKVNPHKAAAVLKAGGGLGALALAGVL |
| Ga0207762_10308492 | 3300027063 | Tropical Forest Soil | MAPLIFGLVVLALVLWALNAFTKINPHTAAAVLKAGGGVGALALAGV |
| Ga0208995_10312021 | 3300027388 | Forest Soil | MATLIFGLVLLALALYALNAFTKVNPRTAAVVLKTGGGL |
| Ga0209524_10207393 | 3300027521 | Forest Soil | MGSLIFGLVVLALGLLALNAFTKVNPHKAATVLKAGGGLGALALAGVLGAR |
| Ga0209527_11259551 | 3300027583 | Forest Soil | MATIIFGLVVLALVLWALNAFTKVNPQTAAVVLKTGG |
| Ga0209329_11085271 | 3300027605 | Forest Soil | MATILFGLVVLALVLWALNAFTKVNPQTAAIVLKTGGGLGALAV |
| Ga0268266_110702902 | 3300028379 | Switchgrass Rhizosphere | MTLIFGLVVLALLLWALHAFTKVKPQTAAVVLKTGGGLGA |
| Ga0268264_121020841 | 3300028381 | Switchgrass Rhizosphere | MTLIFGLVLLALLLWALHAFTKVKPQTAAVVLKTGGGLGAIAVAGLLG |
| Ga0137415_105393892 | 3300028536 | Vadose Zone Soil | MASLIFGVLVLALALWALSAFTKVNPHTAAAVLKAGGGL |
| Ga0307315_100976731 | 3300028721 | Soil | MTLIFGLVVLALLLWALHAFTKVKPQTAAVVLKTGG |
| Ga0307297_100153431 | 3300028754 | Soil | MTLIFGLVLLALLLWALHAFTKVKPQTAAVVLKTGGGLGAIAVAGL |
| Ga0307280_101567492 | 3300028768 | Soil | MTLIFGLVLLALLLWALHAFTKVKPQTAAVVLKTGG |
| Ga0307320_101561372 | 3300028771 | Soil | MALIFGLVVLALLLWALHAFTKVKPQTAAVVLKTGGGLGALAV |
| Ga0307306_100413431 | 3300028782 | Soil | MALIFGLVVLALLLWALHAFTKVKPQTAAVVLKTGGGLGA |
| Ga0307299_102663672 | 3300028793 | Soil | MTLIFGLVLLALLLWALHAFTKVKPQTAAVVLKTGGGLGAIAVA |
| Ga0307287_100097894 | 3300028796 | Soil | MALIFGLVVLALLLWALHAFTKVKPQTAAVVLKTGGGLGALAVAGLFGARGR |
| Ga0307284_102349222 | 3300028799 | Soil | MALIFGLVVLALLLWALHAFTKVKPQTAAVVLKTGGGLGALAVAGLL |
| Ga0307503_100128794 | 3300028802 | Soil | MALIFGLVLLALLLWALHAFTKVKPQTAAVVLKTGGGLGAIAVAGLLGARGRLD |
| Ga0307294_100568992 | 3300028810 | Soil | MALIFGLVVLALLLWALHAFTKVKPQTAAVVLKTGGGLGALAVAGLLGA |
| Ga0308309_106391712 | 3300028906 | Soil | MAPLIFGLVVLALALWALNAFTKVNPHTAAAVLKAGGGLGAL |
| Ga0307498_103795591 | 3300031170 | Soil | MTLIFGLVLLALLLWALHAFTKVKPQTAAVVLKTGGGLGAIAVAGLLGAR |
| Ga0318541_107531701 | 3300031545 | Soil | MATIIFGLVVLALVLWALNAFTKVNPQTAAVVLKTGGGLGALAA |
| Ga0318571_100377951 | 3300031549 | Soil | MATIIFGLVVLALALWALNAFTKVNPQTAAVVLKTGGGLGAL |
| Ga0318528_106044291 | 3300031561 | Soil | MGPLLLGLVVLVLALWALNAFTKVNPHSAAAVLKA |
| Ga0318573_106404822 | 3300031564 | Soil | MGPLLLGLVVLVLALWALNSFTKVNPHSAAAVLKAGGGLGALA |
| Ga0318555_101963032 | 3300031640 | Soil | MATIIFGLVVLALVLWALNAFTKVNPQTAAVVLKTGGGLGALAAAGLLG |
| Ga0318494_105555022 | 3300031751 | Soil | MAQIIFGLVVLALVLWALNAFTKVKPQTAAVVLKTGGGLGALAAAGLLGVR |
| Ga0318554_101272803 | 3300031765 | Soil | MAQIIFGLVVLALVLWALNAFTKVNPQTAAVVLKTGGGLGALAAAGLLG |
| Ga0318521_100110196 | 3300031770 | Soil | MATIIFGLVVLALALWALNAFTKVNPQTAAVVFKTGG |
| Ga0318547_106521852 | 3300031781 | Soil | MATVIFGLVVLALLLWALNAFTKVKPHTAAVVLKTGGGLGALAVAGVLG |
| Ga0318547_110122341 | 3300031781 | Soil | MATIVFGLVVLALALWALNAFTKVNPQTAAVVLKTGGGLGALAAAGLLG |
| Ga0318512_105554792 | 3300031846 | Soil | MASLLFGVVVLALALWALNAFTRVDPRRAAAVLKAGGGV |
| Ga0318512_106734592 | 3300031846 | Soil | MAQIIFGLVVLALALWALNAFTKVNPQTAAVVLKTGGGLGALAAAGLLGVRGRL |
| Ga0306925_103679071 | 3300031890 | Soil | MAPLLFGVVLLVLALVALNAFTKVNPQTAAAVLKAGGGLGALAV |
| Ga0306925_109426241 | 3300031890 | Soil | MAPLIFGLVVLALALWALNAFTKINPHTAAAVLKAGGGLGALA |
| Ga0306922_113852271 | 3300032001 | Soil | MAPLLFGVVLLVLALVALNAFTKVNPHTAAAVLKAGGGLGALAVAGVLG |
| Ga0318507_101317552 | 3300032025 | Soil | MAQIIFGLVVLALVLWALNAFTKVNPQTAAVVLKTGGGLG |
| Ga0318505_100678231 | 3300032060 | Soil | MATIIFGLVVLALALWALNAFTKVNPQTAAVVLKTGGGLG |
| Ga0318504_103185042 | 3300032063 | Soil | MATIIFGLVVLALALWALNAFTKVNPQTAAVVLKTGG |
| Ga0318553_104895901 | 3300032068 | Soil | MATVIFGLVVLALLLWALNAFTKVKPQTAAVVLKTGGGLG |
| Ga0307470_108368322 | 3300032174 | Hardwood Forest Soil | MAALVFGVVVLVLALWALNTFTKVNPHTAAVVLKTGGGLGALGL |
| Ga0306920_1030879391 | 3300032261 | Soil | MATLLFGLVVLALVLYALNAFRKVNPHTAAVVLKTGGGIGALAIAGVL |
| Ga0318519_106864632 | 3300033290 | Soil | MATVIFGLVVLALLLWALNAFTKVKPQTAAVVLKTGGGLGALAVAGVLG |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |