Metagenome / Metatranscriptome Family F103141

Basic Information
Family ID	F103141
Family Type	Metagenome / Metatranscriptome
Number of Sequences	101
Average Sequence Length	40 residues
Representative Sequence	VIPAGYTVGAVEKPTVTQVGASNVLVADIRVSTYYTQTN
Number of Associated Samples	88
Number of Associated Scaffolds	101

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	1.98 %
% of genes near scaffold ends (potentially truncated)	98.02 %
% of genes from short scaffolds (< 2000 bps)	85.15 %
Associated GOLD sequencing projects	85
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.27

Most Common Taxonomy
Group	Duplodnaviria (79.208 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (18.812 % of family members)
Environment Ontology (ENVO)	Unclassified (44.554 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (55.446 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 44.78% Coil/Unstructured: 55.22%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 101 Family Scaffolds
PF12850	Metallophos_2	0.99
PF04860	Phage_portal	0.99

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	80.20 %
Unclassified	root	N/A	19.80 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	80.20 %
Unclassified	root	N/A	19.80 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	79.21 %
Unclassified	root	N/A	19.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	79.21 %
Unclassified	root	N/A	19.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	79.21 %
Unclassified	root	N/A	19.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	79.21 %
Unclassified	root	N/A	19.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	79.21 %
Unclassified	root	N/A	19.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	79.21 %
Unclassified	root	N/A	19.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000756\|JGI12421J11937_10005535	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4986	Open in IMG/M
3300002220\|MLSBCLC_10388002	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1110	Open in IMG/M
3300002471\|metazooDRAFT_1489198	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	992	Open in IMG/M
3300004112\|Ga0065166_10400399	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	573	Open in IMG/M
3300004241\|Ga0066604_10391425	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	558	Open in IMG/M
3300005528\|Ga0068872_10544162	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	620	Open in IMG/M
3300005583\|Ga0049085_10076678	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1171	Open in IMG/M
3300005805\|Ga0079957_1191274	Not Available	996	Open in IMG/M
3300006030\|Ga0075470_10106134	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	837	Open in IMG/M
3300006030\|Ga0075470_10153290	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	672	Open in IMG/M
3300006639\|Ga0079301_1117694	Not Available	803	Open in IMG/M
3300006802\|Ga0070749_10157749	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1317	Open in IMG/M
3300006802\|Ga0070749_10513726	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	652	Open in IMG/M
3300006805\|Ga0075464_10482329	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	758	Open in IMG/M
3300006805\|Ga0075464_10533186	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	720	Open in IMG/M
3300006917\|Ga0075472_10345319	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	735	Open in IMG/M
3300007165\|Ga0079302_1008670	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2740	Open in IMG/M
3300007169\|Ga0102976_1001869	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2019	Open in IMG/M
3300007304\|Ga0102689_1117540	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1324	Open in IMG/M
3300007319\|Ga0102691_1008622	Not Available	570	Open in IMG/M
3300007541\|Ga0099848_1101844	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1101	Open in IMG/M
3300007542\|Ga0099846_1027652	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2189	Open in IMG/M
3300008107\|Ga0114340_1228848	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	589	Open in IMG/M
3300008111\|Ga0114344_1017704	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2901	Open in IMG/M
3300008264\|Ga0114353_1324078	Not Available	620	Open in IMG/M
3300008266\|Ga0114363_1201881	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	609	Open in IMG/M
3300008448\|Ga0114876_1240393	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	572	Open in IMG/M
3300008450\|Ga0114880_1004450	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7512	Open in IMG/M
3300008450\|Ga0114880_1176710	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	741	Open in IMG/M
3300008450\|Ga0114880_1258965	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	536	Open in IMG/M
3300009081\|Ga0105098_10434696	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	657	Open in IMG/M
3300009081\|Ga0105098_10713667	Not Available	533	Open in IMG/M
3300009111\|Ga0115026_11878453	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	509	Open in IMG/M
3300009155\|Ga0114968_10413519	Not Available	734	Open in IMG/M
3300009160\|Ga0114981_10717820	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	528	Open in IMG/M
3300009165\|Ga0105102_10063572	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1654	Open in IMG/M
3300009168\|Ga0105104_10109448	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1487	Open in IMG/M
3300009180\|Ga0114979_10076753	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2077	Open in IMG/M
3300009419\|Ga0114982_1186386	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	642	Open in IMG/M
3300010368\|Ga0129324_10413004	Not Available	520	Open in IMG/M
3300010374\|Ga0114986_1083273	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	578	Open in IMG/M
3300010388\|Ga0136551_1091239	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	535	Open in IMG/M
3300012663\|Ga0157203_1017486	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1078	Open in IMG/M
3300012705\|Ga0157555_1107358	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	973	Open in IMG/M
3300012707\|Ga0157623_1108498	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	521	Open in IMG/M
3300012708\|Ga0157595_1109876	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	789	Open in IMG/M
3300012712\|Ga0157598_1103537	Not Available	936	Open in IMG/M
3300012714\|Ga0157601_1004008	Not Available	1008	Open in IMG/M
3300012714\|Ga0157601_1030968	Not Available	791	Open in IMG/M
3300012720\|Ga0157613_1024599	Not Available	659	Open in IMG/M
3300012729\|Ga0157625_1038203	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	557	Open in IMG/M
3300012730\|Ga0157602_1277002	Not Available	1284	Open in IMG/M
3300012763\|Ga0138289_1030298	Not Available	545	Open in IMG/M
3300012772\|Ga0138287_1113172	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1367	Open in IMG/M
3300012968\|Ga0129337_1439629	Not Available	794	Open in IMG/M
3300013295\|Ga0170791_10618220	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1080	Open in IMG/M
3300013295\|Ga0170791_15075224	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1127	Open in IMG/M
3300016697\|Ga0180057_1141140	Not Available	593	Open in IMG/M
3300017723\|Ga0181362_1033468	Not Available	1092	Open in IMG/M
3300017754\|Ga0181344_1146020	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	676	Open in IMG/M
3300017754\|Ga0181344_1152684	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	659	Open in IMG/M
3300017774\|Ga0181358_1193477	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	669	Open in IMG/M
3300018682\|Ga0188851_1012424	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1101	Open in IMG/M
3300020048\|Ga0207193_1064552	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3646	Open in IMG/M
3300020549\|Ga0207942_1018624	Not Available	892	Open in IMG/M
3300021438\|Ga0213920_1015976	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1985	Open in IMG/M
3300022190\|Ga0181354_1223811	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	549	Open in IMG/M
3300023179\|Ga0214923_10068785	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2557	Open in IMG/M
3300024298\|Ga0255178_1038134	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	955	Open in IMG/M
3300024348\|Ga0244776_10348999	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	996	Open in IMG/M
3300024484\|Ga0256332_1147747	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	504	Open in IMG/M
3300024556\|Ga0256341_1056917	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	794	Open in IMG/M
3300024557\|Ga0255283_1088943	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	664	Open in IMG/M
3300024572\|Ga0255268_1133311	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	618	Open in IMG/M
3300024865\|Ga0256340_1020509	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1667	Open in IMG/M
3300024867\|Ga0255267_1146836	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	543	Open in IMG/M
3300025075\|Ga0209615_103877	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	891	Open in IMG/M
3300025655\|Ga0208795_1155718	Not Available	566	Open in IMG/M
3300025872\|Ga0208783_10066285	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1626	Open in IMG/M
3300027499\|Ga0208788_1015210	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2624	Open in IMG/M
3300027693\|Ga0209704_1199178	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	584	Open in IMG/M
3300027697\|Ga0209033_1161662	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	690	Open in IMG/M
3300027710\|Ga0209599_10135949	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	652	Open in IMG/M
3300027721\|Ga0209492_1179450	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	732	Open in IMG/M
3300027782\|Ga0209500_10162038	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1042	Open in IMG/M
3300028027\|Ga0247722_10027171	All Organisms → Viruses → Predicted Viral	2318	Open in IMG/M
3300028286\|Ga0256331_1037100	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1104	Open in IMG/M
3300031565\|Ga0307379_10937092	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	745	Open in IMG/M
3300031787\|Ga0315900_10535756	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	876	Open in IMG/M
3300031951\|Ga0315904_10055362	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4396	Open in IMG/M
3300031951\|Ga0315904_10068459	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3858	Open in IMG/M
3300031963\|Ga0315901_10948752	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	607	Open in IMG/M
3300031963\|Ga0315901_11085986	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	551	Open in IMG/M
3300033816\|Ga0334980_0091984	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1264	Open in IMG/M
3300034012\|Ga0334986_0029055	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3670	Open in IMG/M
3300034012\|Ga0334986_0346094	Not Available	772	Open in IMG/M
3300034012\|Ga0334986_0403716	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	694	Open in IMG/M
3300034095\|Ga0335022_0470599	Not Available	662	Open in IMG/M
3300034102\|Ga0335029_0618717	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	603	Open in IMG/M
3300034104\|Ga0335031_0004663	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	10233	Open in IMG/M
3300034106\|Ga0335036_0176563	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1500	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.01%
Engineered	Engineered	0.99%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	91.09%
Terrestrial	Environmental → Terrestrial	7.92%
Wastewater	Engineered → Wastewater	0.99%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	77.23%
Marine	Environmental → Aquatic → Marine	13.86%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	6.93%
Soil	Environmental → Terrestrial → Soil	0.99%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.99%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	37.62%
Lentic	Environmental → Aquatic → Freshwater → Lentic	14.85%
Coastal	Environmental → Aquatic → Marine → Coastal	12.87%
River	Environmental → Aquatic → Freshwater → River	7.92%
Sediment	Environmental → Aquatic → Freshwater → Sediment	6.93%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	6.93%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	5.94%
Pond	Environmental → Aquatic → Freshwater → Pond	1.98%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.99%
Creek	Environmental → Aquatic → Freshwater → Creek	0.99%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.99%
Clay	Environmental → Terrestrial → Soil → Clay	0.99%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	0.99%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	36.63%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	12.87%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	11.88%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	7.92%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	6.93%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	6.93%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	5.94%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	1.98%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	0.99%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.99%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.99%
Unclassified	Environmental → Aquatic → Freshwater → Pond → Unclassified	0.99%
Sediment	Environmental → Aquatic → Freshwater → Pond → Sediment	0.99%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	0.99%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.99%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	0.99%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	0.99%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	18.81%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	11.88%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	10.89%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	7.92%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	5.94%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	5.94%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	5.94%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	4.95%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	4.95%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	3.96%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.98%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.99%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	0.99%
Lake	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake	0.99%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	0.99%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	0.99%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	0.99%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.99%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.99%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.99%
Pond Fresh Water	Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water	0.99%
Freshwater	Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater	0.99%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	0.99%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	0.99%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.99%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	0.99%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.99%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	0.99%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000756	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011	Environmental	Open in IMG/M
3300002220	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011	Engineered	Open in IMG/M
3300002471	Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013	Environmental	Open in IMG/M
3300004112	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)	Environmental	Open in IMG/M
3300004241	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11	Environmental	Open in IMG/M
3300005528	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG	Environmental	Open in IMG/M
3300005583	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300006030	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA	Environmental	Open in IMG/M
3300006639	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11	Environmental	Open in IMG/M
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300006917	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA	Environmental	Open in IMG/M
3300007165	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16	Environmental	Open in IMG/M
3300007169	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects	Environmental	Open in IMG/M
3300007304	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300007319	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300007541	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG	Environmental	Open in IMG/M
3300007542	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG	Environmental	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008111	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA	Environmental	Open in IMG/M
3300008264	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR	Environmental	Open in IMG/M
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300008450	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009419	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT	Environmental	Open in IMG/M
3300010368	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA	Environmental	Open in IMG/M
3300010374	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17	Environmental	Open in IMG/M
3300010388	Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015	Environmental	Open in IMG/M
3300012663	Freshwater microbial communities from Indian River, Ontario, Canada - S50	Environmental	Open in IMG/M
3300012705	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES047 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012707	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012708	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012712	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES121 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012714	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012720	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012729	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012730	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012763	Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012772	Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012968	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013295	northern Canada Lakes metatranscriptome co-assembly	Environmental	Open in IMG/M
3300016697	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES156 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300017723	Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300018682	Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020549	Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021438	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300023179	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510	Environmental	Open in IMG/M
3300024298	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d	Environmental	Open in IMG/M
3300024348	0.2um to 3um size fraction coassembly	Environmental	Open in IMG/M
3300024484	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024556	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024557	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024572	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024865	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024867	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025075	Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025655	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)	Environmental	Open in IMG/M
3300025872	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300027499	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes)	Environmental	Open in IMG/M
3300027693	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027697	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027721	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300028027	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC	Environmental	Open in IMG/M
3300028286	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031565	Soil microbial communities from Risofladan, Vaasa, Finland - UN-2	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300031963	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116	Environmental	Open in IMG/M
3300033816	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005	Environmental	Open in IMG/M
3300034012	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027	Environmental	Open in IMG/M
3300034095	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034104	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.27
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.27
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F103141

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12421J11937_100055351	3300000756	Freshwater And Sediment	SGYEVGAVQRPTVTQVGASNLLVADISVSTYYTQTN*
MLSBCLC_103880021	3300002220	Hydrocarbon Resource Environments	KVIPAGYTIGSVEKPTVTQVGPSNVLVSDIRVSTYYTQTN*
metazooDRAFT_14891983	3300002471	Lake	SVLAVIPNGYEVSSVERPTVSQVGASTLLIADIRVSTYYNQT*
Ga0065166_104003991	3300004112	Freshwater Lake	MSVLAVIPVGYIVSSVERPTVSQVGASTLLISDIRVSTYYTQTA*
Ga0066604_103914251	3300004241	Freshwater	SVVAVIPVGYDVQVVDRPTVTQVGASNLLVADIRVSTWYTQTA*
Ga0068872_105441621	3300005528	Freshwater Lake	AGYTVGAVEKPTVTQVGPSNCLVADIRVSTYYTQTN*
Ga0049085_100766784	3300005583	Freshwater Lentic	QILAVIPSGYIVGQIERPTVTSVGASNLLASDINVSTYYTQTN*
Ga0079957_11912744	3300005805	Lake	GYIVGSVERPTVTTIGASTMLIADIRVSTYYTQTN*
Ga0075470_101061341	3300006030	Aqueous	IPDGYTVGPVERPSVTQVGAVNLLVADIRVSTYYTQTT*
Ga0075470_101532901	3300006030	Aqueous	EQLIFSVLAVIPDGYTVGPVERPSVTQVGAVNLLVADIRVSTYYTQTN*
Ga0079301_11176941	3300006639	Deep Subsurface	AVIPNGYVVGSVDRPTVTQVGASNLLISDITVSTYYQQTT*
Ga0070749_101577494	3300006802	Aqueous	VIPDGYTVGPVERPSVTQVGAVNLLVADIRVSTYYTQTN*
Ga0070749_105137263	3300006802	Aqueous	FSVLAVIPDGYTVGPVERPSVTQVGAVNLLVADIRVSTYYTQTT*
Ga0075464_104823291	3300006805	Aqueous	ITSVVAVIPAGYDLQVVDRPTVTQVGASNLLVADIRVSTWYTQTA*
Ga0075464_105331861	3300006805	Aqueous	IPVGYTIGAVEKPTVTQVGPSNVLVADIRVSTYYTQTN*
Ga0075472_103453191	3300006917	Aqueous	PDGYTVGPVERPSVTQVGAVNLLVADIRVSTYYTQTN*
Ga0079302_10086701	3300007165	Deep Subsurface	GYVVGSVDRPTVTQVGASNLLISDITVSTYYQQTT*
Ga0102976_10018695	3300007169	Freshwater Lake	GYTVGPVERPSVTQVGAVNLLVADIRVSTYYTQTN*
Ga0102689_11175404	3300007304	Freshwater Lake	NLPSGYIVGEVNRPTVTQVGSANQLVADIRVSTYFQN*
Ga0102691_10086221	3300007319	Freshwater Lake	PSGYIVGEVNRPTVTQVGSANQLVADIRVSTYFQN*
Ga0099848_11018444	3300007541	Aqueous	ISVVSAIPAGYEVGAVQRPTVTQVGASNLLVADISVATYYTQTN*
Ga0099846_10276525	3300007542	Aqueous	VAVIPTGYDVQVVDRPTVTQVGASNLLVADIRVSTWYTQTA*
Ga0114340_12288482	3300008107	Freshwater, Plankton	GYTVGAVEKPTVTQVGPSNVLVSDIRVSTYYTQTN*
Ga0114344_10177041	3300008111	Freshwater, Plankton	TSVVAVIPAGYDLQVVDRPTVTQVGASNLLVADIRVSTWYTQTA*
Ga0114353_13240783	3300008264	Freshwater, Plankton	GYIVGQVERPTVTTIGASTMLIADIRVSTYYTQTN*
Ga0114363_12018812	3300008266	Freshwater, Plankton	SVLAVIPDGYTVGPVERPTVTQVGAVNLLVADIRVSTYYTQTN*
Ga0114876_12403932	3300008448	Freshwater Lake	VSILGAMPSGYIVGAVERPTVVQIGAGSFLAADISVSTQYTQTN*
Ga0114880_10044501	3300008450	Freshwater Lake	PAGYTVGAVEKPTVTQVGPSNVLVADIRVSTYYTQTN*
Ga0114880_11767101	3300008450	Freshwater Lake	LITSVVTSIPGGYEVSAVERPTVTQVGASNLLVADIRVSTYYTQTN*
Ga0114880_12589652	3300008450	Freshwater Lake	VIPAGYVVSTVERPTVTQVGASTLLIADIRVSTYYTQTT*
Ga0105098_104346961	3300009081	Freshwater Sediment	TSVVAVIPNGYEVQAVDRPTVTTVGASTLLVADIRVATWYTQTA*
Ga0105098_107136672	3300009081	Freshwater Sediment	IPNGYIVGAVERPTVTQVGASTLLISDINVSTYYQQTT*
Ga0115026_118784532	3300009111	Wetland	GYTIGAVEKPTVTQVGPSNVLVADIRVSTYYTQTN*
Ga0114968_104135193	3300009155	Freshwater Lake	PSGYEVSSVERPAVSQVGASTLLIADIRVSTYYNQT*
Ga0114981_107178201	3300009160	Freshwater Lake	LVISVLKVIPNGYTIGAVEKPTVTQVGPSNVLVADIRVSTYYTQTN*
Ga0105102_100635721	3300009165	Freshwater Sediment	NLEQLVISVLKVIPVGYTIGAVEKPTVTQVGPSNVLVADIRVSTYYTQTN*
Ga0105104_101094481	3300009168	Freshwater Sediment	SVVAVIPAGYELQVVDRPTVTTVGASTLLVADIRVSTWYTQTA*
Ga0114979_100767535	3300009180	Freshwater Lake	ESVVLAIPAGYEVSDVQRPTVTQVGASNLLVADIGVSTHYTRTV*
Ga0114982_11863861	3300009419	Deep Subsurface	YIVSSVERPTVSQVGASTLLISDIRVSTYYTQTA*
Ga0129324_104130041	3300010368	Freshwater To Marine Saline Gradient	VIPSGYVVGSVDRPTVTQVGASNLLISDITVSTYYQQTT*
Ga0114986_10832732	3300010374	Deep Subsurface	YTIGSVEKPTVTQVGPSNVLVADIRVSTYYTQTN*
Ga0136551_10912391	3300010388	Pond Fresh Water	IPAGYEVGAVQRPTVTQVGASNLLVADISVATYYTQTN*
Ga0157203_10174861	3300012663	Freshwater	LEQLVISVLKVIPVGYTIGAVEKPTVTQVGPSNVLVADIRVSTYYTQTN*
Ga0157555_11073581	3300012705	Freshwater	DNLEQLVISVLKVIPVGYTIGAVEKPTVTQVGPSNVLVADIRVSTYYTQTN*
Ga0157623_11084982	3300012707	Freshwater	LEQLVISVLKVIPVGYTIGSVEKPTVTQVGPSNVLVADIRVSTYYTQTN*
Ga0157595_11098761	3300012708	Freshwater	VGYTIGSVEKPTVTQVGPSNVLVADIRVSTYYTQTN*
Ga0157598_11035373	3300012712	Freshwater	PNGYVVGSVDRPTVTQVGASNLLISDITVSTYYQQTT*
Ga0157601_10040081	3300012714	Freshwater	NGYVVGSVDRPTVTQVGASNLLISDITVSTYYQQTT*
Ga0157601_10309681	3300012714	Freshwater	NGYIVGEVERPTVTTIGASTMLIADIRVSTYYEQTI*
Ga0157613_10245993	3300012720	Freshwater	ILAVIPNGYIVGAVERPTVTQVGASTLLISDINVSTYYQQTT*
Ga0157625_10382032	3300012729	Freshwater	PVGYTIGSVEKPTVTQVGPSNVLVADIRVSTYYTQTN*
Ga0157602_12770021	3300012730	Freshwater	IPNGYVVGSVDRPTVTQVGASNLLISDITVSTYYQQTT*
Ga0138289_10302981	3300012763	Freshwater Lake	GYEVSSVERPTVSQVGASTLLIADIRVSTYYNQT*
Ga0138287_11131721	3300012772	Freshwater Lake	VIPKGYEVSSVERPTVSQVGASTLLIADIRVSTYYNQT*
Ga0129337_14396293	3300012968	Aqueous	PNGYIVGAVSRPSVTNVGAATMLVSDIEVSTYYTQTT*
Ga0170791_106182204	3300013295	Freshwater	PVGYTIGSVEKPTVTQVGASNVLVADIRVSTYYTQTN*
Ga0170791_150752241	3300013295	Freshwater	PVGYTIEAVEKPTVTQVGPSNCLVADVRVSTYYTQTT*
Ga0180057_11411401	3300016697	Freshwater	NGYVVGSVDRPTVTQVGASNLLISDITVSTYYQQTT
Ga0181362_10334684	3300017723	Freshwater Lake	LAVIPNGYIVGQVERPTVTTIGASTMLIADIRVSTYYTQTN
Ga0181344_11460203	3300017754	Freshwater Lake	KVIPVGYTIGAVEKPTVTQVGPSNCLVADIRVSTYYTQTN
Ga0181344_11526841	3300017754	Freshwater Lake	IIPAGYDVQVVDRPTVTQVGASNLLVADIRVSTWYTQTA
Ga0181358_11934773	3300017774	Freshwater Lake	GYTIGAVEKPTVTQVGPSNVLVADIRVSTYYTQTN
Ga0188851_10124244	3300018682	Freshwater Lake	GYTVGAVEKPTVTQVGPSNVLVADIRVSTYYTQTN
Ga0207193_10645524	3300020048	Freshwater Lake Sediment	MSVLAVIPVGYTIGAVEKPTVTQVGASNVLVADIRVSTYYT
Ga0207942_10186243	3300020549	Freshwater	GYIVGSVDRPTVTQVGASTLLISDINVSTYYQQTT
Ga0213920_10159761	3300021438	Freshwater	VMSVLAAIPSGYEVGSVEKPTVTQVGASNVLVADIRVSTYYNQTN
Ga0181354_12238111	3300022190	Freshwater Lake	SLDNLEQLVISVLKVIPVGYTIGSVEKPTVTQVGPSNVLVADIRVSTYYTQTN
Ga0214923_100687851	3300023179	Freshwater	IMSVLAVIPNGYEVSSVERPTVSQVGASTLLIADIRVSTYYNQT
Ga0255178_10381343	3300024298	Freshwater	FSVLAVIPDGYTVGPVERPSVTQVGAVNLLVADIRVSTYYTQTN
Ga0244776_103489991	3300024348	Estuarine	IPAGYEVQVVDRPTVTQVGASNLLVADIRVSTWYTQTA
Ga0256332_11477471	3300024484	Freshwater	DNLEQLVISVLKVIPAGYTVGAVEKPTVTQVGASNVLVADIRVSTYYTQTN
Ga0256341_10569171	3300024556	Freshwater	VIPAGYTVGAVEKPTVTQVGASNVLVADIRVSTYYTQTN
Ga0255283_10889433	3300024557	Freshwater	KVIPAGYTVGAVEKPTVTQVGASNVLVADIRVSTYYTQTN
Ga0255268_11333112	3300024572	Freshwater	GYTVGAVEKPTVTQVGASNVLVADIRVSTYYTQTN
Ga0256340_10205091	3300024865	Freshwater	PDGYTVGPVERPSVTQVGAVNLLVADIRVSTYYTQTN
Ga0255267_11468362	3300024867	Freshwater	DGYTVGPVERPSVTQVGAVNLLVADIRVSTYYTQTN
Ga0209615_1038771	3300025075	Freshwater	IPVGYTIGAVEKPTVTQVGPSNVLVADIRVSTYYTQTN
Ga0208795_11557181	3300025655	Aqueous	LIESVVLAIPAGYEVSDVQRPTVTQIGASNLLVADIVVSTHYTRTV
Ga0208783_100662855	3300025872	Aqueous	IFSVLAVIPDGYTVGPVERPSVTQVGAVNLLVADIRVSTYYTQTT
Ga0208788_10152105	3300027499	Deep Subsurface	LAVIPNGYVVGSVDRPTVTQVGASNLLISDITVSTYYQQTT
Ga0209704_11991781	3300027693	Freshwater Sediment	AGYAVGAVEKPTVTQVGPSNVLVADIRVSTYYTQTN
Ga0209033_11616623	3300027697	Freshwater Lake	LIMSVLAVIPVGYTIESVEKPTVTQVGPSNVLVSDVRVSTYYTQTT
Ga0209599_101359491	3300027710	Deep Subsurface	VGYIVSSVERPTVSQVGASTLLISDIRVSTYYTQTA
Ga0209492_11794501	3300027721	Freshwater Sediment	NGYEVQVVDRPTVTQVGASNLLVADIRVSTWYTQTA
Ga0209500_101620384	3300027782	Freshwater Lake	EQLIESVVLAIPAGYEVSDVQRPTVTQVGASNLLVADIGVSTHYTRTV
Ga0247722_100271715	3300028027	Deep Subsurface Sediment	PAGYTIGAVEKPTVTQVGPSNCLVADIRVSTYYTQTN
Ga0256331_10371001	3300028286	Freshwater	GYTVGPVERPSVTQVGAVNLLVADIRVSTYYTQTN
Ga0307379_109370923	3300031565	Soil	KVIPAGYTVGAVEKPTVTQVGPSNVLVADIRVSTYYTQTN
Ga0315900_105357561	3300031787	Freshwater	VIPAGYTVGAVEKPTVTQVGPSNVLVSDIRVSTYYTQTN
Ga0315904_100553627	3300031951	Freshwater	NGYIVGQVERPTVTTIGASTMLIADIRVSTYYTQTN
Ga0315904_100684596	3300031951	Freshwater	GYTIGAIEKPTVTQVAASNVLVADIRVSTYYTQTN
Ga0315901_109487521	3300031963	Freshwater	VAVIPNGYEVQAVDRPTVTTVGASTLLVADIRVSTWYTQTA
Ga0315901_110859862	3300031963	Freshwater	SLDNLEQLVISVLKVIPVGYTVGAVEKPTVTQVGPSNVLVADIRVSTYYTQTN
Ga0334980_0091984_3_113	3300033816	Freshwater	SGYVVSTVERPTVTQVGASTLLIADIRVSTYYTQTT
Ga0334986_0029055_3545_3670	3300034012	Freshwater	LKVIPTGYTIGAVEKPTVTQVGPSNVLVADIRVSTYYTQTN
Ga0334986_0346094_3_149	3300034012	Freshwater	EQLIMSILAVIPSGYVVGSVDRPTVTQVGASNLLISDITVSTYYQQTT
Ga0334986_0403716_3_116	3300034012	Freshwater	PAGYIVGAVEKPTVTQVGPSNVLVADIRVSTYYTQTN
Ga0335022_0470599_487_621	3300034095	Freshwater	MSILAIIPAGYIVGSVERPTVTQVGASTLLVSDINVSTYYQQTT
Ga0335029_0618717_435_602	3300034102	Freshwater	PASLDNLEQLVISVLKVIPAGYTVGAVEKPTVTQVGPSNVLVADIRVSTYYTQTN
Ga0335031_0004663_3_128	3300034104	Freshwater	LKVIPAGYTVGAVEKPTVTQVGPSNVLVSDIRVSTYYTQTN
Ga0335036_0176563_3_140	3300034106	Freshwater	IFSVLAVIPDGYTVGPVGQPSVTQVGAVNLLVADIRVSTYYTQTN

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign