NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F102859

Metagenome / Metatranscriptome Family F102859

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102859
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 51 residues
Representative Sequence TSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG
Number of Associated Samples 90
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.99 %
% of genes near scaffold ends (potentially truncated) 98.02 %
% of genes from short scaffolds (< 2000 bps) 84.16 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (99.010 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(27.723 % of family members)
Environment Ontology (ENVO) Unclassified
(71.287 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(78.218 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 2.08%    β-sheet: 60.42%    Coil/Unstructured: 37.50%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF03354TerL_ATPase 0.99
PF09636XkdW 0.99
PF13539Peptidase_M15_4 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG4626Phage terminase-like protein, large subunit, contains N-terminal HTH domainMobilome: prophages, transposons [X] 0.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002408|B570J29032_109359265All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage712Open in IMG/M
3300002835|B570J40625_100080590All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4211Open in IMG/M
3300003277|JGI25908J49247_10024487All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1768Open in IMG/M
3300003393|JGI25909J50240_1010361All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2260Open in IMG/M
3300004096|Ga0066177_10139984All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage958Open in IMG/M
3300004763|Ga0007746_1007998All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage629Open in IMG/M
3300004767|Ga0007750_1409027All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage617Open in IMG/M
3300004769|Ga0007748_11320986All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage629Open in IMG/M
3300004769|Ga0007748_11637759All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage682Open in IMG/M
3300004790|Ga0007758_11075798All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage877Open in IMG/M
3300004790|Ga0007758_11343652All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage986Open in IMG/M
3300004792|Ga0007761_11037055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage680Open in IMG/M
3300004796|Ga0007763_10037147All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage806Open in IMG/M
3300005528|Ga0068872_10568919All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage603Open in IMG/M
3300005582|Ga0049080_10176064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage712Open in IMG/M
3300006802|Ga0070749_10032571All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3240Open in IMG/M
3300006805|Ga0075464_10249699All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1061Open in IMG/M
3300007363|Ga0075458_10174762All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage662Open in IMG/M
3300007708|Ga0102859_1189411All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage610Open in IMG/M
3300008110|Ga0114343_1087473All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1106Open in IMG/M
3300008450|Ga0114880_1037874All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2111Open in IMG/M
3300009155|Ga0114968_10710862All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage526Open in IMG/M
3300009163|Ga0114970_10224331All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1096Open in IMG/M
3300009183|Ga0114974_10004566All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10378Open in IMG/M
3300010160|Ga0114967_10280049All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage863Open in IMG/M
3300010370|Ga0129336_10508182All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage649Open in IMG/M
3300010370|Ga0129336_10699322All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage537Open in IMG/M
3300010885|Ga0133913_11072105All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2077Open in IMG/M
3300010885|Ga0133913_12833152All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1166Open in IMG/M
3300011381|Ga0102688_1535005All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
3300012715|Ga0157599_1200428All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300012717|Ga0157609_1140445All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage631Open in IMG/M
3300012724|Ga0157611_1236762All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage889Open in IMG/M
3300012755|Ga0138281_1095152All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage619Open in IMG/M
3300012768|Ga0138276_1166681All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage811Open in IMG/M
3300012775|Ga0138280_1106983All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage635Open in IMG/M
3300013087|Ga0163212_1143071All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage757Open in IMG/M
(restricted) 3300013126|Ga0172367_10702470All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage533Open in IMG/M
(restricted) 3300013126|Ga0172367_10726196All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
(restricted) 3300013138|Ga0172371_10385000All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1061Open in IMG/M
3300013295|Ga0170791_14057527All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage604Open in IMG/M
3300013295|Ga0170791_15872036All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage652Open in IMG/M
(restricted) 3300014720|Ga0172376_10611467All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage597Open in IMG/M
3300016691|Ga0180055_1163514All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage683Open in IMG/M
3300017761|Ga0181356_1002444All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7819Open in IMG/M
3300017777|Ga0181357_1188707All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage742Open in IMG/M
3300017778|Ga0181349_1054186All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1567Open in IMG/M
3300017778|Ga0181349_1075485All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1289Open in IMG/M
3300017780|Ga0181346_1226750All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage663Open in IMG/M
3300019784|Ga0181359_1240296All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage556Open in IMG/M
3300020221|Ga0194127_10884891All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
3300020549|Ga0207942_1003368All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2484Open in IMG/M
3300020551|Ga0208360_1027097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage751Open in IMG/M
3300022190|Ga0181354_1040585All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1543Open in IMG/M
3300022190|Ga0181354_1097577All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage959Open in IMG/M
3300022407|Ga0181351_1191574All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage693Open in IMG/M
3300023708|Ga0228709_1093206All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage610Open in IMG/M
3300024485|Ga0256318_1067822All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage765Open in IMG/M
3300024487|Ga0255222_1028607All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage822Open in IMG/M
3300024531|Ga0255228_1036881All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage974Open in IMG/M
3300024560|Ga0256306_1047249All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1051Open in IMG/M
3300024853|Ga0255252_1119202All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage500Open in IMG/M
3300024856|Ga0256304_1072844All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage699Open in IMG/M
3300024863|Ga0255246_1111519All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage638Open in IMG/M
3300025283|Ga0208048_1084741All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage688Open in IMG/M
3300025896|Ga0208916_10234742All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage796Open in IMG/M
3300026568|Ga0255240_1057430All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage882Open in IMG/M
3300027608|Ga0208974_1121825All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage681Open in IMG/M
3300027688|Ga0209553_1126115All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage895Open in IMG/M
3300027697|Ga0209033_1010482All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4128Open in IMG/M
(restricted) 3300027730|Ga0247833_1171378All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage844Open in IMG/M
3300027736|Ga0209190_1383943All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage510Open in IMG/M
3300027760|Ga0209598_10280685All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage661Open in IMG/M
3300027772|Ga0209768_10068738All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1811Open in IMG/M
3300027798|Ga0209353_10007117All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5574Open in IMG/M
3300027798|Ga0209353_10401560All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300027892|Ga0209550_10411259All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage835Open in IMG/M
3300027963|Ga0209400_1001675All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage17475Open in IMG/M
3300027963|Ga0209400_1106870All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1291Open in IMG/M
3300028025|Ga0247723_1052493All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1160Open in IMG/M
3300028113|Ga0255234_1081198All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage855Open in IMG/M
3300028113|Ga0255234_1145116All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage624Open in IMG/M
3300028394|Ga0304730_1167800All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage864Open in IMG/M
(restricted) 3300028553|Ga0247839_1152304All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1004Open in IMG/M
(restricted) 3300028559|Ga0247831_1094320All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1325Open in IMG/M
(restricted) 3300028569|Ga0247843_1032669All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3439Open in IMG/M
(restricted) 3300028571|Ga0247844_1035100All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3312Open in IMG/M
3300031758|Ga0315907_10294266All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1335Open in IMG/M
3300031787|Ga0315900_10744894All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage685Open in IMG/M
3300032397|Ga0315287_11148648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage897Open in IMG/M
3300034012|Ga0334986_0586496All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage533Open in IMG/M
3300034018|Ga0334985_0249258All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1141Open in IMG/M
3300034022|Ga0335005_0587042All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage606Open in IMG/M
3300034062|Ga0334995_0562128All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage671Open in IMG/M
3300034092|Ga0335010_0237851All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1083Open in IMG/M
3300034093|Ga0335012_0466708All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage605Open in IMG/M
3300034101|Ga0335027_0124985All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1924Open in IMG/M
3300034106|Ga0335036_0015205All Organisms → cellular organisms → Bacteria6261Open in IMG/M
3300034112|Ga0335066_0077274All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2148Open in IMG/M
3300034122|Ga0335060_0005301All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8594Open in IMG/M
3300034200|Ga0335065_0361999All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage900Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake27.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater25.74%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake13.86%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater9.90%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.97%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.98%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.98%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.99%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.99%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.99%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.99%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.99%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.99%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300004096Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2)EnvironmentalOpen in IMG/M
3300004763Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004767Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004790Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004792Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004796Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011381Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012715Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012717Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012724Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012755Freshwater microbial communities from Lake Montjoie, Canada - M_140807_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012768Freshwater microbial communities from Lake Montjoie, Canada - M_130710_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012775Freshwater microbial communities from Lake Montjoie, Canada - M_140625_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013138 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12mEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300016691Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES124 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020549Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020551Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300023708Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024485Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024487Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024531Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024560Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024853Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024856Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024863Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025283Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026568Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027688Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027697Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027730 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8mEnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027760Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028113Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028394Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300028553 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16mEnvironmentalOpen in IMG/M
3300028559 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1mEnvironmentalOpen in IMG/M
3300028569 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8mEnvironmentalOpen in IMG/M
3300028571 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034018Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J29032_10935926533300002408FreshwaterLDGLLASSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
B570J40625_10008059013300002835FreshwaterEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG*
JGI25908J49247_1002448713300003277Freshwater LakeLLSSSGSTSXKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG*
JGI25909J50240_101036113300003393Freshwater LakeSGSTSIKAAIEVDKTLSGAVQTLRVVSASPGTIQSASIDYLSYQYSVELIG*
Ga0066177_1013998413300004096Freshwater LakeASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
Ga0007746_100799813300004763Freshwater LakeLSSSGSTSIKAAIEVDKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG*
Ga0007750_140902713300004767Freshwater LakeSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
Ga0007748_1132098623300004769Freshwater LakeSSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
Ga0007748_1163775913300004769Freshwater LakeVGRMSEKDGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG*
Ga0007758_1107579833300004790Freshwater LakeLIASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
Ga0007758_1134365233300004790Freshwater LakeLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG*
Ga0007761_1103705513300004792Freshwater LakeSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
Ga0007763_1003714733300004796Freshwater LakeKAAIEADATLSGAVQTLRVTSATAGSVQVASIDYLAYRYNVELIG*
Ga0068872_1056891913300005528Freshwater LakeIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
Ga0049080_1017606413300005582Freshwater LenticDKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG*
Ga0070749_1003257163300006802AqueousSGSTSIKSAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
Ga0075464_1024969913300006805AqueousIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
Ga0075458_1017476223300007363AqueousLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG*
Ga0102859_118941113300007708EstuarineKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG*
Ga0114343_108747353300008110Freshwater, PlanktonAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
Ga0114880_103787413300008450Freshwater LakeIIVMVGRMSEKDGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG*
Ga0114968_1071086213300009155Freshwater LakeTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG*
Ga0114970_1022433153300009163Freshwater LakeSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
Ga0114974_1000456613300009183Freshwater LakeLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
Ga0114967_1028004923300010160Freshwater LakePTLSGACQTLRVTTATSGSIQVGAIDYLAYRFRTELIG*
Ga0129336_1050818223300010370Freshwater To Marine Saline GradientSTSVKTAIEGDATLSGAVQTVRVASATAGSVQIAGNDYLAYRYSLDMIG*
Ga0129336_1069932213300010370Freshwater To Marine Saline GradientSGAVQTLRVTQATSGMITVANIDYLSYRYEVTLIG*
Ga0133913_1107210513300010885Freshwater LakeKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG*
Ga0133913_1283315213300010885Freshwater LakeDGQSRLDGLLASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
Ga0102688_153500523300011381Freshwater LakeGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
Ga0157599_120042823300012715FreshwaterSSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG*
Ga0157609_114044513300012717FreshwaterLLSSSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG*
Ga0157611_123676233300012724FreshwaterVMVGRMSEKDGQSRLDGLLSSSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG*
Ga0138281_109515213300012755Freshwater LakeSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG*
Ga0138276_116668113300012768Freshwater LakeSIKTAIEADKTLSGAVQTLRVVSASPGTVTSANIDYLSYQYSVELIG*
Ga0138280_110698313300012775Freshwater LakeLASSGSSSIKTAIEADKTLSGAVQTLRVVSASPGSITSANIDYLSYQYSVELIG*
Ga0163212_114307133300013087FreshwaterLSGAIQTLRVVSATPGTLTSANIDYLSYQYSVELIG*
(restricted) Ga0172367_1070247013300013126FreshwaterLASSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
(restricted) Ga0172367_1072619613300013126FreshwaterSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
(restricted) Ga0172371_1038500043300013138FreshwaterASSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
Ga0170791_1405752723300013295FreshwaterLLASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
Ga0170791_1587203623300013295FreshwaterQSSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG*
(restricted) Ga0172376_1061146713300014720FreshwaterSSVKAAIEGDVTLSGAVQTLRVTAATAGSVTVAGNDYLAYRYTLELMG*
Ga0180055_116351423300016691FreshwaterMVGRMSEKDGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG
Ga0181356_1002444143300017761Freshwater LakeASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG
Ga0181357_118870713300017777Freshwater LakeRMSEKDGQSRLDGLLSSSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG
Ga0181349_105418613300017778Freshwater LakeADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG
Ga0181349_107548513300017778Freshwater LakeMSEKDGQSRLDGLIASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG
Ga0181346_122675033300017780Freshwater LakeEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG
Ga0181359_124029613300019784Freshwater LakeDKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG
Ga0194127_1088489113300020221Freshwater LakeTLSGAVQTLRVIAATAGSVTVAGNDYLAYRYTLELMG
Ga0207942_100336863300020549FreshwaterERNGQERLDGLLASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG
Ga0208360_102709713300020551FreshwaterGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG
Ga0181354_104058513300022190Freshwater LakeNKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG
Ga0181354_109757713300022190Freshwater LakeNSATCNIIVMVGRMSEKDGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG
Ga0181351_119157423300022407Freshwater LakeMSEKDGQSRLDGLLQSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG
Ga0228709_109320623300023708FreshwaterKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG
Ga0256318_106782223300024485FreshwaterGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG
Ga0255222_102860713300024487FreshwaterADATLSGAVQTLRVTSATAGSVQVASIDYLAYRYNVELIG
Ga0255228_103688113300024531FreshwaterAIEADATLSGAVQTLRVTSATAGSVQVASIDYLAYRYNVELIG
Ga0256306_104724913300024560FreshwaterSTSVKAAIEADATLSGAVQTLRVTSATAGSVQVASIDYLAYRYNVELIG
Ga0255252_111920223300024853FreshwaterFDSATCNIIVMVGRMSEKDGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG
Ga0256304_107284413300024856FreshwaterDATLSGAVQTLRVTSATAGSVQVASIDYLAYRYNVELIG
Ga0255246_111151913300024863FreshwaterLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG
Ga0208048_108474113300025283FreshwaterSDKTLSGAIQTLRVVSATPGTLTSANIDYLSYQYSVELIG
Ga0208916_1023474233300025896AqueousDAYLASDGSSSVKAAIEADKTLSGAVQTLRVTQATSGMITVANIDYLSYRYEVTLIG
Ga0255240_105743013300026568FreshwaterTGSTSVKAAIEADATLSGAVQTLRVTSATAGSVQVASIDYLAYRYNVELIG
Ga0208974_112182523300027608Freshwater LenticDGLLSSSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG
Ga0209553_112611533300027688Freshwater LakeSTSIKAAIEVDKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG
Ga0209033_101048263300027697Freshwater LakeKAAIEADATLSGAVQTLRVTSATAGSVQVASIDYLAYRYNVELIG
(restricted) Ga0247833_117137813300027730FreshwaterNRGFDSATCNIIVMVGRMSEKDGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG
Ga0209190_138394313300027736Freshwater LakeNIIVMVGRMSEKDGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG
Ga0209598_1028068513300027760Freshwater LakeLASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG
Ga0209768_1006873813300027772Freshwater LakeAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG
Ga0209353_1000711713300027798Freshwater LakeEVDKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG
Ga0209353_1040156013300027798Freshwater LakeMVGRMSEKDGQSRLDGLLQSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG
Ga0209550_1041125933300027892Freshwater LakeDKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG
Ga0209400_100167513300027963Freshwater LakeTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG
Ga0209400_110687013300027963Freshwater LakeKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG
Ga0247723_105249353300028025Deep Subsurface SedimentERLDGLLASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG
Ga0255234_108119833300028113FreshwaterEADATLSGAVQTLRVTSATAGSVQVASIDYLAYRYNVELIG
Ga0255234_114511623300028113FreshwaterEGDVTLGGAVQTLRVTNATAGSVQVASTDYLAYRYNVELIG
Ga0304730_116780033300028394Freshwater LakeQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELI
(restricted) Ga0247839_115230413300028553FreshwaterSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG
(restricted) Ga0247831_109432043300028559FreshwaterMSEKDGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG
(restricted) Ga0247843_103266913300028569FreshwaterRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG
(restricted) Ga0247844_103510013300028571FreshwaterIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG
Ga0315907_1029426613300031758FreshwaterVEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG
Ga0315900_1074489423300031787FreshwaterRNGQERLDGLLASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG
Ga0315287_1114864833300032397SedimentEKDGQSRLDGLLSSSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG
Ga0334986_0586496_267_4073300034012FreshwaterVKAAIEGDQTLSGAVQTLRVTQASAGSVQVANIDYLAYRYVVELIG
Ga0334985_0249258_1011_11393300034018FreshwaterIEADKTLSGAVLTLRVVSASPGTITSANIDYLSYQYSVELIG
Ga0335005_0587042_2_1753300034022FreshwaterDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG
Ga0334995_0562128_544_6693300034062FreshwaterEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG
Ga0335010_0237851_2_1243300034092FreshwaterVDKTLGGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG
Ga0335012_0466708_436_6033300034093FreshwaterLLSSSGSTSIKAAIEVDKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG
Ga0335027_0124985_3_1583300034101FreshwaterSGSTSIKAAVEADKTLGGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG
Ga0335036_0015205_6068_62593300034106FreshwaterDGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG
Ga0335066_0077274_1_1383300034112FreshwaterKAAVEVDKTLGGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG
Ga0335060_0005301_8362_85653300034122FreshwaterMSERSGQERLDGLLASSGSTSIKAAVEVDKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG
Ga0335065_0361999_3_1253300034200FreshwaterADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.