NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F102858

Metagenome / Metatranscriptome Family F102858

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102858
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 77 residues
Representative Sequence MKLTDEQLSEALSVSEEHPVLKAMGQLIDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRELTSGQF
Number of Associated Samples 87
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 81.19 %
% of genes near scaffold ends (potentially truncated) 38.61 %
% of genes from short scaffolds (< 2000 bps) 66.34 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (90.099 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(22.772 % of family members)
Environment Ontology (ENVO) Unclassified
(54.455 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(52.475 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 71.25%    β-sheet: 0.00%    Coil/Unstructured: 28.75%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF08706D5_N 2.97
PF03237Terminase_6N 2.97
PF13884Peptidase_S74 0.99
PF13385Laminin_G_3 0.99
PF10108DNA_pol_B_exo2 0.99
PF00356LacI 0.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.10 %
UnclassifiedrootN/A9.90 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000124|BS_KBA_SWE12_21mDRAFT_c10121767All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage632Open in IMG/M
3300003277|JGI25908J49247_10002165All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6277Open in IMG/M
3300003499|JGI25930J51415_1064218Not Available619Open in IMG/M
3300004481|Ga0069718_14577856All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage536Open in IMG/M
3300005527|Ga0068876_10055532All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2408Open in IMG/M
3300005527|Ga0068876_10396034All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage770Open in IMG/M
3300005527|Ga0068876_10788974Not Available502Open in IMG/M
3300005581|Ga0049081_10314252All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage537Open in IMG/M
3300005805|Ga0079957_1189382All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1003Open in IMG/M
3300005805|Ga0079957_1207157All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage940Open in IMG/M
3300005941|Ga0070743_10076817All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1128Open in IMG/M
3300006802|Ga0070749_10038511All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2947Open in IMG/M
3300007363|Ga0075458_10207364All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300007561|Ga0102914_1189626All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage632Open in IMG/M
3300007590|Ga0102917_1034785All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1763Open in IMG/M
3300007692|Ga0102823_1058764All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1026Open in IMG/M
3300007734|Ga0104986_1853All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage36910Open in IMG/M
3300007864|Ga0105749_1025902All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1089Open in IMG/M
3300008107|Ga0114340_1109706All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2011Open in IMG/M
3300008117|Ga0114351_1088696All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4952Open in IMG/M
3300008266|Ga0114363_1065339All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1400Open in IMG/M
3300008266|Ga0114363_1113081All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage956Open in IMG/M
3300008267|Ga0114364_1088014All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage998Open in IMG/M
3300008448|Ga0114876_1228748All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage599Open in IMG/M
3300008450|Ga0114880_1092776All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1183Open in IMG/M
3300008450|Ga0114880_1278747All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300008996|Ga0102831_1123494All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage861Open in IMG/M
3300009056|Ga0102860_1158460All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage642Open in IMG/M
3300009075|Ga0105090_10062605All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2324Open in IMG/M
3300009161|Ga0114966_10002353All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage16857Open in IMG/M
3300009168|Ga0105104_10120463All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1414Open in IMG/M
3300011011|Ga0139556_1025336All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage863Open in IMG/M
3300011114|Ga0151515_10793All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage13112Open in IMG/M
3300011116|Ga0151516_10746All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14946Open in IMG/M
3300011268|Ga0151620_1008288All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3760Open in IMG/M
3300011339|Ga0153700_10842All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14541Open in IMG/M
3300012726|Ga0157597_1288853Not Available895Open in IMG/M
3300012757|Ga0157628_1111072All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage994Open in IMG/M
3300013087|Ga0163212_1026026All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2078Open in IMG/M
(restricted) 3300013126|Ga0172367_10026732All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5181Open in IMG/M
(restricted) 3300013127|Ga0172365_10027508All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3968Open in IMG/M
(restricted) 3300013128|Ga0172366_10507442All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage722Open in IMG/M
(restricted) 3300013130|Ga0172363_10215497All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1296Open in IMG/M
(restricted) 3300013133|Ga0172362_10056962All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3032Open in IMG/M
(restricted) 3300013133|Ga0172362_10465815All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage871Open in IMG/M
3300013372|Ga0177922_11188343All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage582Open in IMG/M
3300017747|Ga0181352_1098534All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage803Open in IMG/M
3300017777|Ga0181357_1173598Not Available782Open in IMG/M
3300017784|Ga0181348_1237859All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage635Open in IMG/M
3300017785|Ga0181355_1123350All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1059Open in IMG/M
3300017788|Ga0169931_10692233Not Available673Open in IMG/M
3300019784|Ga0181359_1006045All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4005Open in IMG/M
3300020074|Ga0194113_10824736Not Available633Open in IMG/M
3300020159|Ga0211734_11016396All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage997Open in IMG/M
3300020172|Ga0211729_10718853All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3501Open in IMG/M
3300020205|Ga0211731_11216497Not Available588Open in IMG/M
3300021961|Ga0222714_10013312All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6826Open in IMG/M
3300022179|Ga0181353_1041371All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1217Open in IMG/M
3300022752|Ga0214917_10001519All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage29683Open in IMG/M
3300024343|Ga0244777_10030270All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3436Open in IMG/M
3300024346|Ga0244775_10150240All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1966Open in IMG/M
3300024346|Ga0244775_10676109All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage833Open in IMG/M
3300024549|Ga0256308_1005704All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2657Open in IMG/M
3300024560|Ga0256306_1007603All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2687Open in IMG/M
3300024566|Ga0256309_1037573All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1296Open in IMG/M
3300025283|Ga0208048_1005831All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5111Open in IMG/M
3300027142|Ga0255065_1073299Not Available591Open in IMG/M
3300027153|Ga0255083_1036696All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1009Open in IMG/M
3300027278|Ga0208439_1081438Not Available593Open in IMG/M
3300027418|Ga0208022_1049958All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage922Open in IMG/M
3300027693|Ga0209704_1011941All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2085Open in IMG/M
3300027736|Ga0209190_1000482All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage29092Open in IMG/M
3300027743|Ga0209593_10329454All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300027751|Ga0208304_10249537Not Available630Open in IMG/M
3300027816|Ga0209990_10060014All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1915Open in IMG/M
3300027956|Ga0209820_1003150All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4029Open in IMG/M
3300027971|Ga0209401_1062299All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1646Open in IMG/M
3300031784|Ga0315899_10543777All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1105Open in IMG/M
3300031857|Ga0315909_10261511All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1320Open in IMG/M
3300031857|Ga0315909_10304126All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1190Open in IMG/M
3300031857|Ga0315909_10938281All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage529Open in IMG/M
3300031963|Ga0315901_10113753All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2475Open in IMG/M
3300032050|Ga0315906_10585610All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage922Open in IMG/M
3300033979|Ga0334978_0006407All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6366Open in IMG/M
3300033979|Ga0334978_0121422All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1315Open in IMG/M
3300033979|Ga0334978_0156524All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1133Open in IMG/M
3300033980|Ga0334981_0272969All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage758Open in IMG/M
3300033981|Ga0334982_0440496All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage585Open in IMG/M
3300033994|Ga0334996_0088330All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1830Open in IMG/M
3300033994|Ga0334996_0353269All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage708Open in IMG/M
3300033995|Ga0335003_0119706All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1342Open in IMG/M
3300034018|Ga0334985_0001752All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage17312Open in IMG/M
3300034018|Ga0334985_0242158All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1163Open in IMG/M
3300034019|Ga0334998_0147996All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1507Open in IMG/M
3300034072|Ga0310127_002618All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage18270Open in IMG/M
3300034072|Ga0310127_024769All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3538Open in IMG/M
3300034104|Ga0335031_0340593All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage961Open in IMG/M
3300034109|Ga0335051_0052426All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2176Open in IMG/M
3300034116|Ga0335068_0223740All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage974Open in IMG/M
3300034279|Ga0335052_0045244All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2727Open in IMG/M
3300034283|Ga0335007_0494503All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage735Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater22.77%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake11.88%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine8.91%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater7.92%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment4.95%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton4.95%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment4.95%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater4.95%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.96%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.97%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.97%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake1.98%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.98%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water1.98%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.99%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.99%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.99%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.99%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.99%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine0.99%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.99%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000124Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21mEnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003499Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DNEnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007590Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007734Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015JanEnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009056Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3EnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300011011Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300011114Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016FebEnvironmentalOpen in IMG/M
3300011116Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015NovEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300011339Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - HannamEnvironmentalOpen in IMG/M
3300012726Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012757Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300013128 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cmEnvironmentalOpen in IMG/M
3300013130 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2EnvironmentalOpen in IMG/M
3300013133 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2EnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024549Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024560Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024566Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025283Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes)EnvironmentalOpen in IMG/M
3300027142Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300027153Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8hEnvironmentalOpen in IMG/M
3300027278Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes)EnvironmentalOpen in IMG/M
3300027418Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes)EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027751Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027971Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300033979Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003EnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034018Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034072Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-AEnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034109Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034279Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BS_KBA_SWE12_21mDRAFT_1012176723300000124MarineMKLNDEQLSEALSVSEEHPVLKAIGQVIDDTLRDEVHSALLPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRDLTSGQF*
JGI25908J49247_1000216553300003277Freshwater LakeMKLTDEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVLMAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF*
JGI25930J51415_106421813300003499Freshwater LakeMKLTDEQLFEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNERELTSGQF*
Ga0069718_1457785613300004481SedimentMKLNDEQLLEALSVSEEHPVLKAMGQVIDDTLRDEVLMAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF*
Ga0068876_1005553223300005527Freshwater LakeMKLNDEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVHSALLPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRDLTSGQF*
Ga0068876_1039603413300005527Freshwater LakeMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRELTSGQF*
Ga0068876_1078897423300005527Freshwater LakeMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNERELTSGQF*
Ga0049081_1031425223300005581Freshwater LenticMKLNDEQLSEALSVSEEHPVLKAMGQLIDDTLRDEVHSAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF*
Ga0079957_118938223300005805LakeMKLTDEQLSEALSVSEEHPVLKALGQLIDDTLRDEVLNALLPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRGLTSGQF*
Ga0079957_120715723300005805LakeMKLNDEQLSEALSVSEEHPVLKAMGQVIEETLRDEVLNAIMPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRDLTSGQF*
Ga0070743_1007681723300005941EstuarineMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVLNALLPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRELTSGQF*
Ga0070749_1003851123300006802AqueousMKLTDEQLSEALSVSEEHPVLKAMGQLIDDTLRDEVHNAIIPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF*
Ga0075458_1020736413300007363AqueousMRLTDEQLSEALSVSDEHPVVKAFMQILDETLHSEVAYGIQPNLTAEDRAYNCGRAAAVKDLSVSIQTIRGERD*
Ga0102914_118962623300007561EstuarineMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQI
Ga0102917_103478523300007590EstuarineMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISAL*
Ga0102823_105876423300007692EstuarineMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLQDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNERELTSGQF*
Ga0104986_185373300007734FreshwaterMKLTDEQLSEALSVSEEHPVLKAIGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNEKELTSGQF*
Ga0105749_102590213300007864Estuary WaterMKLTDEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVLMAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTS
Ga0114340_110970623300008107Freshwater, PlanktonMKLNDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNERELTSGQF*
Ga0114351_108869673300008117Freshwater, PlanktonMKLTDEQLSEALSVSEEHPVLKAMGQLIDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRELTSGQF*
Ga0114363_106533913300008266Freshwater, PlanktonMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNG
Ga0114363_111308123300008266Freshwater, PlanktonMKLTDEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVHSAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF*
Ga0114364_108801423300008267Freshwater, PlanktonMKLNDEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVHSAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF*
Ga0114876_122874823300008448Freshwater LakeMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYISGRAAAIKDLIAQISALRNERELTSGQF*
Ga0114880_109277623300008450Freshwater LakeMKLTDEQLSEALSVSEEHPVLKAMGQLIDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQ
Ga0114880_127874723300008450Freshwater LakeMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQ
Ga0102831_112349423300008996EstuarineMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRN
Ga0102860_115846023300009056EstuarineMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALR
Ga0105090_1006260533300009075Freshwater SedimentMKLTDEQLSEALSVSEEHPVLKAMGQLIDDTLRDEVLNALLPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRGLTSGQF*
Ga0114966_1000235333300009161Freshwater LakeMKLTNEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVLMAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF*
Ga0105104_1012046313300009168Freshwater SedimentMKLTDEQLSEALSVSEEHPVLKALGQLIDDTLRDEVHSAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF*
Ga0139556_102533613300011011FreshwaterALSVSEEHPVLKAMGQVIDDTLRDEVLMAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF*
Ga0151515_10793163300011114FreshwaterMKLNDEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVLMAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF*
Ga0151516_10746113300011116FreshwaterMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNEKELTSGQF*
Ga0151620_100828823300011268FreshwaterMKLNDEQLSEALSVSEEHPVIKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRELTSGQF*
Ga0153700_1084223300011339FreshwaterMKLNDEQLSEALSVSEEHPVLKAMGQVIDETLRDEVFNAIMPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF*
Ga0157597_128885323300012726FreshwaterMKLTDEQLSEALSVSEEHPVLKAMGQLIDDTLRDEVLNALLPSLSAEDRAYNLGRAAAIKDLIAQISALRNGRGLTSGQF*
Ga0157628_111107223300012757FreshwaterSEEHPVLKAMGQLIDDTLRDEVLNALLPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRGLTSGQF*
Ga0163212_102602623300013087FreshwaterMKLTDEQLSEALSVSEEHPVLKAVAQVIDDAIRDEVYHAITPSLSAEDRAYNAGRAAAIKDLSAQFAALRGGKELTSGQL*
(restricted) Ga0172367_1002673233300013126FreshwaterMKLTDEQLSEALSVSEEHPVLKAVAQVIDDALRDEVYNAIIPSLSAEDRAYNAGRAAAIKDLSAQFTALRGGKELTSGQF*
(restricted) Ga0172365_1002750823300013127SedimentMKLTDEQLSEALSVSEEHPVLKAVAQVIDDALRDEVYSAIIPSLSAEDRAFNAGRAAAIKDLSAQFTALRGGKELTSGQF*
(restricted) Ga0172366_1050744213300013128SedimentEQLSEALSVSEEHPVLKAVAQVIDDALRDEVYNAIIPSLSAEDRAYNAGRAAAIKDLSAQFTALRGGKELTSGQF*
(restricted) Ga0172363_1021549723300013130SedimentSEALSVSEEHPVLKAVAQVIDDALRDEVYNAIIPSLSAEDRAYNAGRAAAIKDLSAQFTALRGGKELTSGQF*
(restricted) Ga0172362_1005696213300013133SedimentMKLTDEQLSEALSVSEEHPVLKAVAQVIDDALRDEVCSAIIPSLSAEDRAFNAGRAAAIKDLSAQFTALRG
(restricted) Ga0172362_1046581523300013133SedimentGKRRDDGIVDLVPQRVVDEQLSEALSVSEEHPVLKAVAQVIDDALRDEVYNAIIPSLSAEDRAYNAGRAAAIKDLSAQFTALRGGKELTSGQF*
Ga0177922_1118834313300013372FreshwaterMKLTDEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVHSALLPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSG
Ga0181352_109853413300017747Freshwater LakeMKLNDEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVLMAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELT
Ga0181357_117359813300017777Freshwater LakeTMKLTDEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVLMAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF
Ga0181348_123785923300017784Freshwater LakeMKLTNEQLSEALSVSEEHPVLKAMGQLIDDTLRDEVLNAIMPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRELTSGQF
Ga0181355_112335023300017785Freshwater LakeMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRGLTSGQF
Ga0169931_1069223323300017788FreshwaterMKLTDEQLSEALSVSEEHPVLKAVAQVIDDALRDEVYNAIIPSLSAEDRAYNAGRAAAIKDLSAQFTALRGGKELTSGQF
Ga0181359_100604533300019784Freshwater LakeMKLTDEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVLMAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF
Ga0194113_1082473623300020074Freshwater LakeMKLTDEQLSEALSVSEEHPVLKAVAQVIDDALRDEVYHAITPSLSAEDRAYNAGRAAAIKDLSAQFAALRGGKELTSGQF
Ga0211734_1101639613300020159FreshwaterMKLNDEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVLMAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTS
Ga0211729_1071885373300020172FreshwaterLSVSEEHPVLKAMSQVIDDTLRDEVLMAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF
Ga0211731_1121649713300020205FreshwaterKLNDEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVLMAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF
Ga0222714_1001331293300021961Estuarine WaterMKLNDEQLSEALSVSEEHPVIKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRELTSGQF
Ga0181353_104137123300022179Freshwater LakeMKLTDEQLFEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNERELTSGQF
Ga0214917_10001519103300022752FreshwaterMKLTDEQLSEALSVSEEHPVLKAMGQLIDDTLRDEVLNALLPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRELTSGQF
Ga0244777_1003027023300024343EstuarineMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVLNALLPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRELTSGQF
Ga0244775_1015024023300024346EstuarineMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNERELTSGQF
Ga0244775_1067610913300024346EstuarineMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVLNALLPSLSAEDRAYNSGRAAAIKDLIAQI
Ga0256308_100570443300024549FreshwaterVSEEHPVLKAMGQLIDDTLLDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRELTSGQF
Ga0256306_100760323300024560FreshwaterMKLTDEQLSEAISVSEEHQVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRELTSGQF
Ga0256309_103757313300024566FreshwaterSVSEEHPVLKAMGQLIDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRELTSGQF
Ga0208048_100583183300025283FreshwaterMKLTDEQLSEALSVSEEHPVLKAVAQVIDDAIRDEVYHAITPSLSAEDRAYNAGRAAAIKDLSAQFAALRGGKELTSGQL
Ga0255065_107329913300027142FreshwaterHGPPRSPMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRELTSGQF
Ga0255083_103669613300027153FreshwaterPMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRELTSGQF
Ga0208439_108143813300027278EstuarineSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNERELTSGQF
Ga0208022_104995813300027418EstuarineRHHRPPWSPMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNERELTSGQF
Ga0209704_101194113300027693Freshwater SedimentERHYRPTWSPMKLTDEQLSEALSVSEEHPVLKALGQLIDDTLRDEVLNALLPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRGLTSGQF
Ga0209190_1000482223300027736Freshwater LakeMKLTNEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVLMAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF
Ga0209593_1032945423300027743Freshwater SedimentMKLTDEQLSEALSVSEEHPVLKAMGQLIDDTLRDEVLNALLPSLSAEDRAYNSGRAAAIKDLIAQ
Ga0208304_1024953713300027751EstuarineLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRELTSGQF
Ga0209990_1006001423300027816Freshwater LakeMKLNDEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVHSALLPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRDLTSGQF
Ga0209820_100315023300027956Freshwater SedimentMKLTDEQLSEALSVSEEHPVLKALGQLIDDTLRDEVLNALLPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRGLTSGQF
Ga0209401_106229933300027971Freshwater LakeMKLTDEQLLEALSVSEEHPVLKAMGQVIDDTLRDEVLMAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF
Ga0315899_1054377723300031784FreshwaterMKLTDEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVHSAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF
Ga0315909_1026151113300031857FreshwaterMKLTDEQLSEALSVSEEHPVLKAMGQLIDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISAL
Ga0315909_1030412623300031857FreshwaterMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNGR
Ga0315909_1093828113300031857FreshwaterMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISAL
Ga0315901_1011375313300031963FreshwaterMKLTDEQLSEALFVSEEHPVLKAMGQLIDDTLRDEVHNAIIPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF
Ga0315906_1058561023300032050FreshwaterMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRELT
Ga0334978_0006407_5688_59303300033979FreshwaterMKLTDEQLSEALSVSEDHPVLQAMGQVIDDTLRDEVHNALLPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF
Ga0334978_0121422_435_6773300033979FreshwaterMKLNDEQLSEALSVSEEHPVLKAIGQVIDDTLRDEVHSALLPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRDLTSGQF
Ga0334978_0156524_173_4153300033979FreshwaterMKLNEEQLSEALSVSEEHPVLKAMGQVIEDTLRDEVHSALLPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF
Ga0334981_0272969_1_2313300033980FreshwaterMKLTDEQLSEALSVSEEHPVLKAMGQLIDDTLRDEVLNALLPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRGLTS
Ga0334982_0440496_372_5843300033981FreshwaterMKLTDEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVHSALLPSLSAEDRAYNAGRAAAIKDLIAQISALRN
Ga0334996_0088330_2_2053300033994FreshwaterMKLTDEQLSEALSVSEEHPVLKALGQLIDDTLRDEVLNALLPSLSAEDRAYNSGRAAAIKDLIAQISA
Ga0334996_0353269_1_2103300033994FreshwaterMKLNDEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVHSAILPSLSAEDRAYNAGRAAAIKDLIAQISALR
Ga0335003_0119706_250_4923300033995FreshwaterMKLTDEQLSEALSVSEEHPVLKAMSQVIDDTLRDEVLMAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF
Ga0334985_0001752_3333_35753300034018FreshwaterMKLTDEQLSEALSVSEEHPVLKAMGQLIDDTLRDEVLNAILPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRELTSGQF
Ga0334985_0242158_640_8823300034018FreshwaterMKLTDEQLSEALSVSEEHPVLKAMGQLIDDTLRDEVLMAILPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF
Ga0334998_0147996_829_10713300034019FreshwaterMKLTDEQLSEALSVSEDHPVLKAMGQVIDETLRDEVHNALLPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRELTSGQF
Ga0310127_002618_3311_35533300034072Fracking WaterMKLTDEQLSEALSVSEEHPVLKALGQLIDDTLRDEVLNALLPSLSAEDRAYNAGRAAAIKDLIAQISALRNERELTSGQF
Ga0310127_024769_2551_27933300034072Fracking WaterMKLNDEQLSEALSVSEEHPVLKAIGQVIDDTLRDEVLNALLPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRGLTSGQF
Ga0335031_0340593_1_2013300034104FreshwaterMKLNDEQLSEALSVSEEHPVLKAMGQVIDDTLRDEVHSAILPSLSAEDRAYNAGRAAAIKDLIAQIS
Ga0335051_0052426_863_11053300034109FreshwaterMKLTDEQLSEALSVSEDHPVLKAMGQLIDDTLRDEVLNALLPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRGLTSGQF
Ga0335068_0223740_434_6763300034116FreshwaterMKLTDEQLSEALSVSEEHPVLKAMGQLIDDTLRDEVLNALLPSLSAEDRAYNAGRAAAIKDLIAQISALRNGRGLTSGQF
Ga0335052_0045244_2494_27273300034279FreshwaterMKLTDEQLSEALSVSEEHPVLKAMGQLIDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISALRNGRELTSG
Ga0335007_0494503_3_2063300034283FreshwaterMKLTDEQLSEALSVSEEHPVLKAMGQILDDTLRDEVHNAIIPSLSAEDRAYNSGRAAAIKDLIAQISA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.