Basic Information | |
---|---|
Family ID | F102762 |
Family Type | Metagenome |
Number of Sequences | 101 |
Average Sequence Length | 41 residues |
Representative Sequence | VLAHVAGIPVEEALLAAPALLAGVTVIAGYVRATAARPRR |
Number of Associated Samples | 67 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 7.92 % |
% of genes near scaffold ends (potentially truncated) | 22.77 % |
% of genes from short scaffolds (< 2000 bps) | 95.05 % |
Associated GOLD sequencing projects | 64 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (82.178 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (30.693 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.624 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.465 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.24% β-sheet: 5.88% Coil/Unstructured: 55.88% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF05988 | DUF899 | 51.49 |
PF00005 | ABC_tran | 6.93 |
PF00196 | GerE | 1.98 |
PF08327 | AHSA1 | 1.98 |
PF12681 | Glyoxalase_2 | 1.98 |
PF07366 | SnoaL | 1.98 |
PF13088 | BNR_2 | 0.99 |
PF04248 | NTP_transf_9 | 0.99 |
PF00903 | Glyoxalase | 0.99 |
PF00908 | dTDP_sugar_isom | 0.99 |
PF05088 | Bac_GDH | 0.99 |
PF13515 | FUSC_2 | 0.99 |
PF00589 | Phage_integrase | 0.99 |
PF01883 | FeS_assembly_P | 0.99 |
PF00875 | DNA_photolyase | 0.99 |
PF02694 | UPF0060 | 0.99 |
PF00990 | GGDEF | 0.99 |
PF13649 | Methyltransf_25 | 0.99 |
PF01872 | RibD_C | 0.99 |
PF02518 | HATPase_c | 0.99 |
PF07883 | Cupin_2 | 0.99 |
PF12697 | Abhydrolase_6 | 0.99 |
PF10009 | DUF2252 | 0.99 |
PF01047 | MarR | 0.99 |
PF00132 | Hexapep | 0.99 |
PF01545 | Cation_efflux | 0.99 |
COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
---|---|---|---|
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 51.49 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.99 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.99 |
COG0415 | Deoxyribodipyrimidine photolyase | Replication, recombination and repair [L] | 0.99 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.99 |
COG1742 | Uncharacterized inner membrane protein YnfA, drug/metabolite transporter superfamily | General function prediction only [R] | 0.99 |
COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.99 |
COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 0.99 |
COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 0.99 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.99 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.18 % |
Unclassified | root | N/A | 17.82 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002568|C688J35102_119616557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
3300002568|C688J35102_120382605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1028 | Open in IMG/M |
3300005329|Ga0070683_100727545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 951 | Open in IMG/M |
3300005331|Ga0070670_100520807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1059 | Open in IMG/M |
3300005337|Ga0070682_100164917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1534 | Open in IMG/M |
3300005345|Ga0070692_11129445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 555 | Open in IMG/M |
3300005356|Ga0070674_101804619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 554 | Open in IMG/M |
3300005441|Ga0070700_101292905 | Not Available | 613 | Open in IMG/M |
3300005454|Ga0066687_10935322 | Not Available | 517 | Open in IMG/M |
3300005535|Ga0070684_100365826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1327 | Open in IMG/M |
3300005563|Ga0068855_100905342 | Not Available | 932 | Open in IMG/M |
3300005615|Ga0070702_101340829 | Not Available | 583 | Open in IMG/M |
3300005981|Ga0081538_10009454 | All Organisms → cellular organisms → Bacteria | 8138 | Open in IMG/M |
3300006844|Ga0075428_101577537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 687 | Open in IMG/M |
3300006894|Ga0079215_10126666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1176 | Open in IMG/M |
3300006918|Ga0079216_11883633 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300007790|Ga0105679_10815375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1339 | Open in IMG/M |
3300007790|Ga0105679_10820756 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300009094|Ga0111539_10678223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1200 | Open in IMG/M |
3300009094|Ga0111539_12747498 | Not Available | 570 | Open in IMG/M |
3300009100|Ga0075418_12929554 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300009147|Ga0114129_10509753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1570 | Open in IMG/M |
3300009545|Ga0105237_12099173 | Not Available | 574 | Open in IMG/M |
3300009553|Ga0105249_13045959 | Not Available | 538 | Open in IMG/M |
3300009789|Ga0126307_10220464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1523 | Open in IMG/M |
3300009789|Ga0126307_10361670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1169 | Open in IMG/M |
3300009789|Ga0126307_10510241 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300009789|Ga0126307_10549457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 932 | Open in IMG/M |
3300009789|Ga0126307_11126799 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300009789|Ga0126307_11160768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
3300009789|Ga0126307_11355730 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300009840|Ga0126313_10003242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 9327 | Open in IMG/M |
3300009840|Ga0126313_10014402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 5112 | Open in IMG/M |
3300009840|Ga0126313_10611756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 878 | Open in IMG/M |
3300009840|Ga0126313_10953240 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300010039|Ga0126309_10332261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 889 | Open in IMG/M |
3300010040|Ga0126308_11030653 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300010045|Ga0126311_11808523 | Not Available | 518 | Open in IMG/M |
3300010045|Ga0126311_11922358 | Not Available | 503 | Open in IMG/M |
3300010166|Ga0126306_10626764 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300010371|Ga0134125_10674540 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
3300010375|Ga0105239_12866997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 563 | Open in IMG/M |
3300010399|Ga0134127_11168592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 835 | Open in IMG/M |
3300010399|Ga0134127_11594181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
3300012916|Ga0157310_10411280 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300012939|Ga0162650_100104749 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300012988|Ga0164306_11836157 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300013306|Ga0163162_11199039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 861 | Open in IMG/M |
3300014488|Ga0182001_10079315 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300014829|Ga0120104_1094638 | Not Available | 595 | Open in IMG/M |
3300015373|Ga0132257_102635003 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300018051|Ga0184620_10091115 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300018422|Ga0190265_10228558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1894 | Open in IMG/M |
3300018422|Ga0190265_10463294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1375 | Open in IMG/M |
3300018422|Ga0190265_10468665 | Not Available | 1368 | Open in IMG/M |
3300018422|Ga0190265_10662552 | Not Available | 1164 | Open in IMG/M |
3300018422|Ga0190265_10816266 | Not Available | 1055 | Open in IMG/M |
3300018422|Ga0190265_12266703 | Not Available | 645 | Open in IMG/M |
3300018422|Ga0190265_12512182 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300018422|Ga0190265_12944116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
3300018429|Ga0190272_10692616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 915 | Open in IMG/M |
3300018432|Ga0190275_10306887 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
3300018432|Ga0190275_10626112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1126 | Open in IMG/M |
3300018432|Ga0190275_10703285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 1068 | Open in IMG/M |
3300018432|Ga0190275_11269307 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300018432|Ga0190275_11754714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. CPCC 204708 | 699 | Open in IMG/M |
3300018432|Ga0190275_13025985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
3300018466|Ga0190268_11196318 | Not Available | 630 | Open in IMG/M |
3300018466|Ga0190268_11489780 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300018469|Ga0190270_10146797 | All Organisms → cellular organisms → Bacteria | 1908 | Open in IMG/M |
3300018469|Ga0190270_12513044 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300018476|Ga0190274_12233652 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300018476|Ga0190274_13994688 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300018481|Ga0190271_11296691 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300018481|Ga0190271_12195883 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300019377|Ga0190264_10303197 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300019377|Ga0190264_12119887 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300020181|Ga0196958_10014256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2226 | Open in IMG/M |
3300025908|Ga0207643_10650456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
3300025908|Ga0207643_10988869 | Not Available | 544 | Open in IMG/M |
3300025925|Ga0207650_10412071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1120 | Open in IMG/M |
3300025926|Ga0207659_10563774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 969 | Open in IMG/M |
3300025932|Ga0207690_11224112 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300025942|Ga0207689_10890645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
3300025945|Ga0207679_11960262 | Not Available | 534 | Open in IMG/M |
3300025961|Ga0207712_10637480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 925 | Open in IMG/M |
3300026089|Ga0207648_10345778 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300028589|Ga0247818_10950645 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300028721|Ga0307315_10198190 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300028796|Ga0307287_10328304 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300028807|Ga0307305_10372596 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300030513|Ga0268242_1067932 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300031164|Ga0307502_10065901 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300031731|Ga0307405_11498957 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300031852|Ga0307410_10405891 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300031938|Ga0308175_100748347 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300031938|Ga0308175_102351103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 597 | Open in IMG/M |
3300031995|Ga0307409_101429200 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300032074|Ga0308173_11244804 | Not Available | 696 | Open in IMG/M |
3300034143|Ga0334961_003344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2631 | Open in IMG/M |
3300034143|Ga0334961_030907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 916 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 30.69% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 15.84% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.97% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.97% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.97% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 2.97% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.98% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 1.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.98% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.99% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.99% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.99% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.99% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.99% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.99% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300020181 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10 | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300030513 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2) | Environmental | Open in IMG/M |
3300031164 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 16_S | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300034143 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 57SNS | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
C688J35102_1196165572 | 3300002568 | Soil | VLAHIAGIPVEEALVAAPGLLAGLSMIAAYVRATATRPRASADE* |
C688J35102_1203826052 | 3300002568 | Soil | VLAHVAGIPVEEALQAAPALLAGVTVFAGYLRATAARLRR* |
Ga0070683_1007275452 | 3300005329 | Corn Rhizosphere | VFAHVGGLPVEEALQAAPAALAALTVLAGYVRATLARPRR* |
Ga0070670_1005208072 | 3300005331 | Switchgrass Rhizosphere | VLAHVGGVPVEEALQAAPAALAALTVLGGYVRATLARPRR* |
Ga0070682_1001649171 | 3300005337 | Corn Rhizosphere | VFAHVGGLPVEEALQAAPAALAAMTVLAGYLRATLARPRR* |
Ga0070692_111294451 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VFAHVGGLPVEEALQAAPAALAALTVLAGYLRATLARPRR* |
Ga0070674_1018046192 | 3300005356 | Miscanthus Rhizosphere | VFAHVAGIPVEEALQAAPALLAGLAVVAGYIRATAARPRR* |
Ga0070700_1012929052 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VLAHVAGIPVEEALPAAPALPAGAAVIAGTSGRPPRGRRR* |
Ga0066687_109353222 | 3300005454 | Soil | HSDVLAHVAGIPVEEALLAAPALLAGVTVIAGYVRATAARPRR* |
Ga0070684_1003658263 | 3300005535 | Corn Rhizosphere | DVFAHVGGLPVEEALQAAPAALAAMTVLAGYLRATLARPRR* |
Ga0068855_1009053423 | 3300005563 | Corn Rhizosphere | VLAHVAGIPVEEALPAAPALPAGAAVIAGYVRATAAPGR* |
Ga0070702_1013408291 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VFAHVGGVPVEEALQAAPVLLTGLTVFAGYVRATAAGRRRDQ* |
Ga0081538_100094542 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VLAHVAGIPVEEALLVAPALLAGVTVIAGYVRATAARPRR* |
Ga0075428_1015775372 | 3300006844 | Populus Rhizosphere | VLAHVAGIPVEEALQAAPALLAGLTVFAGYLRATAARTRR* |
Ga0079215_101266661 | 3300006894 | Agricultural Soil | VLAHVAGFPVEEALQAAPALLAGLTVLAGYVRATATRPRR* |
Ga0079216_118836332 | 3300006918 | Agricultural Soil | VLAHVAGIPVEEALLAAPALLAGVTVLAGYVRAAATRPRR* |
Ga0105679_108153753 | 3300007790 | Soil | VLAHVGALPVEEALLAAPALLAWVSTIAGYARAHLVRNG* |
Ga0105679_108207562 | 3300007790 | Soil | MFAHIGGVPVEEALTAAPALLASATVLAGYLRATAGRARR* |
Ga0111539_106782232 | 3300009094 | Populus Rhizosphere | VFAHVGGIPVEEALQAAPAALAALTVLAGYVRATLARPRR* |
Ga0111539_127474982 | 3300009094 | Populus Rhizosphere | PSSDVFAHVGCLPVEEALQAAPAALAAMTVLAGYLRATLARPRR* |
Ga0075418_129295542 | 3300009100 | Populus Rhizosphere | VLAHVAGIPVEEALQAAPALLAAVTVIAGYVRAIAARHALAEAEGS |
Ga0114129_105097532 | 3300009147 | Populus Rhizosphere | VLAHVAGIPVEEALQAAPGLLAGLTVIAGYIRATAARRRR* |
Ga0105237_120991732 | 3300009545 | Corn Rhizosphere | AGTTPTTPSSDVFAHVGGLPVEEALQAAPAALAAMTVLAGYLRATLARPRR* |
Ga0105249_130459592 | 3300009553 | Switchgrass Rhizosphere | VLAHVAGIPVEEALLAAPALLAGAAVIAGYVRATAARRRR* |
Ga0126307_102204642 | 3300009789 | Serpentine Soil | VLAHIGGIPLEEALQAAPALLTGLTVIAGYLRTTAARPRR* |
Ga0126307_103616702 | 3300009789 | Serpentine Soil | VLAHVAGIPVEEALLAAPVLLAGVTAIAGYVRATAARSRR* |
Ga0126307_105102412 | 3300009789 | Serpentine Soil | VFAHVAGIPVEEALVAGPALLAGVTLIAGYLRATVARPRR* |
Ga0126307_105494572 | 3300009789 | Serpentine Soil | VLAHVAGIPLEEALQAAPALLAGVTVIAGYVRATAARPRR* |
Ga0126307_111267992 | 3300009789 | Serpentine Soil | VLAHVAGVPVEEALQAAPALLAAVTMIAGYVRATVARPRR* |
Ga0126307_111607682 | 3300009789 | Serpentine Soil | MTVLAHVAGIPVEEALLAAPALLAGVTVIAGYLRATAARPRR* |
Ga0126307_113557301 | 3300009789 | Serpentine Soil | VLAHIAGIPVEEALMAAPALLTGLTVIAGYLRASAARPRR* |
Ga0126313_100032425 | 3300009840 | Serpentine Soil | VLAHVAGISVEEALPAGVSVIAGDVRATAARRAS* |
Ga0126313_100144022 | 3300009840 | Serpentine Soil | VLAHVAGIPVEEALLAAPALLAGVTVIAGYVRATAARPRR* |
Ga0126313_106117562 | 3300009840 | Serpentine Soil | VLAHVAGVPVEEALLAAPGLMAGVTVVAGYVRATGARLRR* |
Ga0126313_109532402 | 3300009840 | Serpentine Soil | VLAHVAGLPVEEALLAEPALVAGVTVAAGYVRATAARPRR* |
Ga0126309_103322612 | 3300010039 | Serpentine Soil | VLAHVAGFPVEEALTAAPALLAALTMIAGYVRATAARSRR* |
Ga0126308_110306531 | 3300010040 | Serpentine Soil | VLAHVAGIPVEEALLAAPVLLAGVTAIAGYVRATAARPRR* |
Ga0126311_118085232 | 3300010045 | Serpentine Soil | VLAHVAGIPIEEALLAAPALLAGLTVIAGYVRAIAARPRR* |
Ga0126311_119223582 | 3300010045 | Serpentine Soil | VLAHVAGIPAEEALLAEPALVAGVTVAAGYVRATAARPRR* |
Ga0126306_106267642 | 3300010166 | Serpentine Soil | VLAHVGGIPVEEALAAAPALLAGVTVIAGYVRATAARARR* |
Ga0134125_106745401 | 3300010371 | Terrestrial Soil | VLAHVAGIPVEEALMAAPALLAGVTMIAGYVRATAARPRR* |
Ga0105239_128669972 | 3300010375 | Corn Rhizosphere | VLAHVAGIPVEEALLAAPALLAGAALIAGYVRATAARRRR* |
Ga0134127_111685922 | 3300010399 | Terrestrial Soil | AHVGGLPVEEALQAAPAALAAMTVLAGYLRATLARPRR* |
Ga0134127_115941812 | 3300010399 | Terrestrial Soil | VLAHVAGIPVEEASMAAPALLAGVTMIAGYVRATAARPRR* |
Ga0157310_104112802 | 3300012916 | Soil | VLAHVAGIPVEEALQAAPALLAGATVIAGYIRATAARRR* |
Ga0162650_1001047491 | 3300012939 | Soil | VLAHVAGIPVEEALLAAPALLAGVTVLAGYVRATAARPRR* |
Ga0164306_118361571 | 3300012988 | Soil | VLAHVAGIAVEEVLLAAPALLAGMTVIVGYVRRAW |
Ga0163162_111990392 | 3300013306 | Switchgrass Rhizosphere | PVEEALQAAPVLLTGLTVFAGYVRATAAGRRRDQ* |
Ga0182001_100793152 | 3300014488 | Soil | VLAHVAGIPVEEALLAAPALVAAVTVIAGYLRATVARPRR* |
Ga0120104_10946381 | 3300014829 | Permafrost | TSTTTHSDVLAHVAGIPIEEALLAAPALLAGVTVIAGYVRATAARPRR* |
Ga0132257_1026350031 | 3300015373 | Arabidopsis Rhizosphere | VFAHVGGLPVEEALQAAPAALAALTVLAGHVRATLARPRR* |
Ga0184620_100911152 | 3300018051 | Groundwater Sediment | VLAHVAGFPVEEALQAAPALLAGVTVMVGYVRATAARPRR |
Ga0190265_102285581 | 3300018422 | Soil | SDVLAHVAGIPVEEALLAAPALLAGVTVIAGYVRATAARPRR |
Ga0190265_104632941 | 3300018422 | Soil | SDVLAHVAGIPVEEALLAAPALLASVTVIVSYVRATAARPRR |
Ga0190265_104686653 | 3300018422 | Soil | VLAHVAGIPVEEALLAAPALLASLTMIAGYVRTAAARPRR |
Ga0190265_106625523 | 3300018422 | Soil | VLAHVAGIPVEEALMAAPALLAGVTVIAGYVRATVARPRR |
Ga0190265_108162663 | 3300018422 | Soil | AHVAGIPVEEALLAAPALLASVTVIAGYVRAAASRPRR |
Ga0190265_122667032 | 3300018422 | Soil | VLAHVAGIPVEEALLAAPALLAGVTAIAGYVRATAARPRR |
Ga0190265_125121822 | 3300018422 | Soil | VLAHVAGVPVEEALLAAPALLTGLTVIAGYVRATAARARSRGPRTY |
Ga0190265_129441162 | 3300018422 | Soil | VLAHVAGIPVEEALLAAPALLAGVTVIAGYVRALRT |
Ga0190272_106926162 | 3300018429 | Soil | TTRSDVFAHVGGIPVEEALRAAPALLAGLTVIAGYLRATAARPRR |
Ga0190275_103068871 | 3300018432 | Soil | TTTHSDVLAHVAGIPVEEALLAAPALLAGVTVIAGYVRATATRPRR |
Ga0190275_106261121 | 3300018432 | Soil | TTTHSDVLAHVAGIPVEEALLAAPALLAGVTVIAGYVRATAARPRR |
Ga0190275_107032851 | 3300018432 | Soil | TAHSDVLAHVAGIPVEEALAAAPALLAGLTVIAGYVRATAARPRH |
Ga0190275_112693072 | 3300018432 | Soil | VLAHVRGIPVEEALLAAPALLAGVTVIAGYIRATAARPRR |
Ga0190275_117547142 | 3300018432 | Soil | MLAHISGIPVEEALQAAPALLASVTVIAGYIRATAARPRR |
Ga0190275_130259852 | 3300018432 | Soil | MFAHVAGFPVEEALLAAPALLAGVTVIVGYVRATAARPRRSRRPR |
Ga0190268_111963181 | 3300018466 | Soil | VLAHIAGIPVEEALQAAPALLASVTVIAGYVRATAARPRR |
Ga0190268_114897802 | 3300018466 | Soil | VLAHIAGFPVEEALQAAPALLAGVTVIAGYLRATAARPRR |
Ga0190270_101467972 | 3300018469 | Soil | VLLAHVAGFPVEEALLAAPALLAGVTVIAGYIRATVARPRR |
Ga0190270_125130441 | 3300018469 | Soil | MTSTTTHSDVLAHVAGIPVEEALLAAPALLAGVTVIAGYVRATAARPRR |
Ga0190274_122336522 | 3300018476 | Soil | VVLAHVAGFPVEEALLAAPALLAGVTVIGGYIRATVARPRR |
Ga0190274_139946882 | 3300018476 | Soil | VFAHVAGIPLEEALLAAPALLAGVTVIAGYVRATAARPRR |
Ga0190271_112966912 | 3300018481 | Soil | VLAHVAGIPVEEALLAAPALLAGVAVVAGYVRATAARLRR |
Ga0190271_121958832 | 3300018481 | Soil | VLAHVVGIPVEEALLAAPALLAGVTVIAGYVRATAASLRR |
Ga0190264_103031972 | 3300019377 | Soil | VLAHVAGIPVEEALLAAPALLAGVTVIAGYVRATAARPRR |
Ga0190264_121198871 | 3300019377 | Soil | VLAHVAGIPVEEALLAVPALLAGATAIAGYVRATAARPRR |
Ga0196958_100142564 | 3300020181 | Soil | VLAHVSGIPVEEALLAAPALLAGVTAIAGYVRATAARPRTRRPTD |
Ga0207643_106504562 | 3300025908 | Miscanthus Rhizosphere | TTSTTGRSDVLAHVGGVPVEEALQAAPAALAALTVLGGYVRATLARPRR |
Ga0207643_109888691 | 3300025908 | Miscanthus Rhizosphere | TTTHSDVLAHVAGIPVEEALPAGVTVIAGCVRHDTRRPR |
Ga0207650_104120713 | 3300025925 | Switchgrass Rhizosphere | VLAHVGGVPVEEALQAAPAALAALTVLGGYVRATLARPRR |
Ga0207659_105637742 | 3300025926 | Miscanthus Rhizosphere | PTTPRSDVLAHVGGLPVEEALQAAPAALAALTVLAGYVRATLARPRR |
Ga0207690_112241121 | 3300025932 | Corn Rhizosphere | VFAHVGGLPVEEALQAAPAALAALTVLAGYVRATLARPRR |
Ga0207689_108906452 | 3300025942 | Miscanthus Rhizosphere | VLAHVGGLPVEEALQAAPAALAAMTVLAGYLRATLARPRR |
Ga0207679_119602621 | 3300025945 | Corn Rhizosphere | VLAHVAGIPVEEALLAAPALLAGAAVIAGYVRATAARLRR |
Ga0207712_106374801 | 3300025961 | Switchgrass Rhizosphere | GTTPTTPRSDVFAHVGGLPVEEALQAAPAALAAMTVLAGYLRATLARPRR |
Ga0207648_103457782 | 3300026089 | Miscanthus Rhizosphere | VFAHVGGLPVEEALQAAPAALAALTVLAGYLRATLARPRR |
Ga0247818_109506452 | 3300028589 | Soil | VLAHIAGIPVEEALQAAPALLAGATVIAGYVRATAARSRRGIRRGV |
Ga0307315_101981902 | 3300028721 | Soil | VLAHVAGIPVEEALLAAPALLAGVTVIAGYVRATAARHRR |
Ga0307287_103283042 | 3300028796 | Soil | VLAHVAGIPVEEALLAAPALLAGVTVIVGYIRATAARPRR |
Ga0307305_103725961 | 3300028807 | Soil | VLAHVAGIPVEEALLAAPALLAGVTVIAGYVRATAARPRPCPQCTSP |
Ga0268242_10679322 | 3300030513 | Soil | VLAHVAGIPVEEALLAAPALLAGVTVIAGYVRATAARPRQLRSRIAHASA |
Ga0307502_100659012 | 3300031164 | Soil | VLAHVAGIPVEEALLAAPALLAGVTVIVGYVRATVARPRR |
Ga0307405_114989571 | 3300031731 | Rhizosphere | VFAHVAGIPVEEALLAAPALLAGVTVIAGYVRATAARPRR |
Ga0307410_104058912 | 3300031852 | Rhizosphere | VLAHAAGIPVEEALLAAPALLAGVTVIAGYVRAAAARPRR |
Ga0308175_1007483472 | 3300031938 | Soil | VLAHVAGIPVEESLLAAPALLAGVTVIAAYVRATAARRRR |
Ga0308175_1023511031 | 3300031938 | Soil | VLAHVAGIPVEEALMAAPGALAGLTVLAGYVRATLARPRR |
Ga0307409_1014292002 | 3300031995 | Rhizosphere | VLAHVAGIPVEEALVAAPALLAGVTVIAGYVRATAARPGR |
Ga0308173_112448041 | 3300032074 | Soil | TRSDVFAHVAGIPVEEALTAAPALLAGVTMIAAYVRATAARRRR |
Ga0334961_003344_152_277 | 3300034143 | Sub-Biocrust Soil | MLLAHVGIIPLEEALLAAPALLAGATVIAGYLRTIAVRPRR |
Ga0334961_030907_214_339 | 3300034143 | Sub-Biocrust Soil | MLLAHVGGIPVEEALMAAPALLAGATVIADYVRAIVARPRR |
⦗Top⦘ |