| Basic Information | |
|---|---|
| Family ID | F102740 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MSALGQKQTYALQKAMSALPPIATAKADIRKRSCPLYP |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 66.67 % |
| % of genes near scaffold ends (potentially truncated) | 2.97 % |
| % of genes from short scaffolds (< 2000 bps) | 2.97 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (98.020 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (20.792 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.594 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.455 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 39.39% β-sheet: 0.00% Coil/Unstructured: 60.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 40.59 |
| PF13185 | GAF_2 | 4.95 |
| PF00480 | ROK | 1.98 |
| PF02518 | HATPase_c | 1.98 |
| PF00196 | GerE | 0.99 |
| PF04993 | TfoX_N | 0.99 |
| PF05651 | Diacid_rec | 0.99 |
| PF06186 | DUF992 | 0.99 |
| PF00583 | Acetyltransf_1 | 0.99 |
| PF01042 | Ribonuc_L-PSP | 0.99 |
| PF13545 | HTH_Crp_2 | 0.99 |
| PF00211 | Guanylate_cyc | 0.99 |
| PF06035 | Peptidase_C93 | 0.99 |
| PF02979 | NHase_alpha | 0.99 |
| PF06568 | DUF1127 | 0.99 |
| PF03070 | TENA_THI-4 | 0.99 |
| PF06863 | DUF1254 | 0.99 |
| PF09471 | Peptidase_M64 | 0.99 |
| PF03006 | HlyIII | 0.99 |
| PF00884 | Sulfatase | 0.99 |
| PF13618 | Gluconate_2-dh3 | 0.99 |
| PF13924 | Lipocalin_5 | 0.99 |
| PF00126 | HTH_1 | 0.99 |
| PF03734 | YkuD | 0.99 |
| PF00561 | Abhydrolase_1 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 40.59 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 3.96 |
| COG3835 | Sugar diacid utilization regulator CdaR | Transcription [K] | 1.98 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.99 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.99 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.99 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.99 |
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.99 |
| COG5457 | Uncharacterized conserved protein YjiS, DUF1127 family | Function unknown [S] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 98.02 % |
| All Organisms | root | All Organisms | 1.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300015373|Ga0132257_101902868 | Not Available | 766 | Open in IMG/M |
| 3300025932|Ga0207690_10289954 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300025945|Ga0207679_10336705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1311 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 20.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 18.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.98% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 1.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.99% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.99% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old | Host-Associated | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Host-Associated | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ARSoilOldRDRAFT_0001521 | 3300000044 | Arabidopsis Rhizosphere | MKTTSALGQKQTYALQKAMSALPPIATAKADSRKRS |
| ICChiseqgaiiFebDRAFT_144385321 | 3300000363 | Soil | MSALGHEQTFALHNRMSAFPIATAKADFGNLSCLLS |
| AF_2010_repII_A100DRAFT_10218971 | 3300000655 | Forest Soil | FYGSSADRAMSALGHKQTYAAQNGMSALAPLATAKAEFRKRSCPLYP* |
| JGI11643J12802_107524942 | 3300000890 | Soil | MLFRKMSTLGHKPAFRSAIVMSALPPIATAKADSRKRSC |
| Ga0062593_1004896333 | 3300004114 | Soil | MSALGHKRTFAPQHVTSALPPIATAKADFGKPSCLVYPQEQTCAV* |
| Ga0062595_1001433212 | 3300004479 | Soil | MILWRPMSALGHKQTYALQKAMSAITPIATAKADIGRLSCLLYP |
| Ga0070676_101931341 | 3300005328 | Miscanthus Rhizosphere | MSALGQKQTCAPQNAMSALPLIATAKADIRKRSCPLCLRKRTC |
| Ga0066388_1014846731 | 3300005332 | Tropical Forest Soil | MSALGQKRTYAVQNGMSALPPKATAKADIRKRSCLLYTRKRTC |
| Ga0066388_1021824133 | 3300005332 | Tropical Forest Soil | ANSGILRRGMMSALGQKQTCALQNVMSAVPPTATAKADIGNPSCLLYPQ* |
| Ga0066388_1030837782 | 3300005332 | Tropical Forest Soil | MSALGQKQTYAAHKLMSALPPIATKKADIGNLSCLLYPQ* |
| Ga0068859_1019411462 | 3300005617 | Switchgrass Rhizosphere | MSALGHKQTFALRNAMSALPPKATAKADIRKRSCPL |
| Ga0066905_1002135542 | 3300005713 | Tropical Forest Soil | MSALGQKQTFAAQKVMSALPPKATAKADFGNPSCLLYPQ* |
| Ga0066905_1002168263 | 3300005713 | Tropical Forest Soil | MSALGQKQTYASQQAMSALPPIATAKADIGNPSCLLYPR |
| Ga0066905_1002903852 | 3300005713 | Tropical Forest Soil | MSALGQKQTCALQNVMSALLPIATTKADIGKPSCLLYP |
| Ga0066905_1003130092 | 3300005713 | Tropical Forest Soil | MSALGHKQTYALQKAMSALPPIATAKADFGKPPCLLYP* |
| Ga0066905_1008767322 | 3300005713 | Tropical Forest Soil | MSALGQKQTHAVQQRMSALPPIATAKADMSLASCPLFP |
| Ga0066905_1012029891 | 3300005713 | Tropical Forest Soil | GQKQTHAVQQRMSASPPIATVKADIRKRSCLLYPQKQTCAVH* |
| Ga0066905_1014432401 | 3300005713 | Tropical Forest Soil | SALGHKQTYAVQQPMSALPPIATAKADSCKQSCLLYP* |
| Ga0066903_1003561932 | 3300005764 | Tropical Forest Soil | MSALGQKQTYAAHKLMSALPPIATAKADFPQKSCLLYP |
| Ga0066903_1008920353 | 3300005764 | Tropical Forest Soil | MSALGHKQTYAAHKLMSALPPIATAKADPRKVMSALP |
| Ga0066903_1015165152 | 3300005764 | Tropical Forest Soil | VMSALGKKRAYAAHKVMSALPMIATAKADSRNRSCLLY |
| Ga0066903_1019914481 | 3300005764 | Tropical Forest Soil | MSALGHKQTYAVQQTMSASPPIATSKADIRKRSCPLYPESGHVRRK* |
| Ga0066903_1026649922 | 3300005764 | Tropical Forest Soil | MSALGQKQTYALQKAMSALPPIATMKADIGKPSGLLYP |
| Ga0066903_1039124472 | 3300005764 | Tropical Forest Soil | MSALGQKQTYALQKAMSALPPIATAKADMTVCGCLLYP |
| Ga0066903_1040993582 | 3300005764 | Tropical Forest Soil | MSALGQKQTYALQKAMSALPPIATAKADIRKRSCPLYP |
| Ga0066903_1057230701 | 3300005764 | Tropical Forest Soil | MSALGQKQTYAMQKRMSALAPIATAKADVAQKSCLLYPQ |
| Ga0066903_1059508421 | 3300005764 | Tropical Forest Soil | LGQKQTYAAHKLMSALPPIATAKADFRKRSCPLYP |
| Ga0068858_1020500091 | 3300005842 | Switchgrass Rhizosphere | MSALGHKQTYAVQKAMSASPLIATAKADLRKKRTCAAQQVMSALGQ |
| Ga0075417_101973742 | 3300006049 | Populus Rhizosphere | MSALGQKQTFAPQKAMSALPPIATAKADSRKRSCPLYP |
| Ga0075433_116710871 | 3300006852 | Populus Rhizosphere | MSALGHKRTYAVQQAMSALHPIATAKADFRKTSCLLYPGLRSDLP |
| Ga0075429_1000443851 | 3300006880 | Populus Rhizosphere | MSALGHKRTYAVQKGMSALHPIATAKADFRTSPCPLYP |
| Ga0075426_110157751 | 3300006903 | Populus Rhizosphere | MSALGHKPAYAVHNVMSAWPPIATAKADIRKGHVCF |
| Ga0075424_1016489001 | 3300006904 | Populus Rhizosphere | MSALGQKQTFAPQKVMSALPAKVDIRQRSDLMSFRSSIVS |
| Ga0105245_105170722 | 3300009098 | Miscanthus Rhizosphere | MSALGQKQTCAPQNAMSALPLIATAKADIRKRSCPLCLR |
| Ga0111538_102195904 | 3300009156 | Populus Rhizosphere | MKTTSALGQKQTYALQKAMSALPPIATAKADSRKRSVCF |
| Ga0075423_112312572 | 3300009162 | Populus Rhizosphere | MSALGHKQTFALQKAMSALPPKATAKADIRKRSCPLHP |
| Ga0105242_124380071 | 3300009176 | Miscanthus Rhizosphere | MSALGQKLTFAPQQGMSALPPIATAKADIRKTPCLLCP |
| Ga0105248_109317381 | 3300009177 | Switchgrass Rhizosphere | MSALGHKRTYAPQQAMSAIPPISTAKADIRKSPCPL |
| Ga0126380_104365411 | 3300010043 | Tropical Forest Soil | MSALGQKQTFEVQKGMSALPRIAIAKADSRNGHVRF |
| Ga0126380_120772012 | 3300010043 | Tropical Forest Soil | MSALGQKQTYAVQNAMSALPPIATAKADIGKPSCLLYP |
| Ga0126384_117185552 | 3300010046 | Tropical Forest Soil | MSALGQKQTCARQKAMSALPPIAIAKADFLKRSCPLYPQER |
| Ga0126382_109070682 | 3300010047 | Tropical Forest Soil | MSALGQKQTYAVQQGMSALPPIATGKADISKRSCLLYA |
| Ga0126382_113500782 | 3300010047 | Tropical Forest Soil | MSALGQKQTFAVQNGMSALPPIATAKVDFPQTICLTRKAD |
| Ga0126370_102481221 | 3300010358 | Tropical Forest Soil | MMSALGQKQTYALQKAMSALPPIATAKADIRKRSCLLYPQKR |
| Ga0126370_125009472 | 3300010358 | Tropical Forest Soil | MSALGQKRTFAVQDGMSALIPIATMKADFRKRSCLLYP |
| Ga0126376_102120761 | 3300010359 | Tropical Forest Soil | MSALGQKQTCARQKAMSALPPIATAKADFRKSSSLLYPRKRTFTV |
| Ga0126372_110805682 | 3300010360 | Tropical Forest Soil | LMIVMSALGQKQTCALQNVMSALFPIATAKADFGNPSCLL* |
| Ga0126372_112554252 | 3300010360 | Tropical Forest Soil | MSALGQKQTYAVQNVMSALPLIATAKANSRKRSSPLH |
| Ga0126378_106173181 | 3300010361 | Tropical Forest Soil | MSALGQKQTYAVQNGMSALRPKATAKADIRKSLCPLHPQKLT |
| Ga0126378_133841801 | 3300010361 | Tropical Forest Soil | MSALGQKQTYAPQKGTSALPPIATAKADFGKPSCLLYPQ |
| Ga0126377_130684901 | 3300010362 | Tropical Forest Soil | VDLLLSRMSALGQKQTYAPQNVMSALPPIATEKADFRKRSC |
| Ga0126379_101610733 | 3300010366 | Tropical Forest Soil | MSALGHKRTHAAQNGMSALPPIATAKADSRKRSCLLYPH |
| Ga0126379_104519681 | 3300010366 | Tropical Forest Soil | MSALGQNQTYAVQKAMSALPPIATTKAEIGKTSCPLYP |
| Ga0126381_1007757841 | 3300010376 | Tropical Forest Soil | MSALGQKQTCALQNVMSALPPIATAKADFRKRSCPLYP |
| Ga0157318_10349461 | 3300012482 | Arabidopsis Rhizosphere | MSALGQKQTFAAQKAMSALPPIATAKADIRKRSCLLYPQERT |
| Ga0126375_103434472 | 3300012948 | Tropical Forest Soil | MSALGQKRTYAVHQLMSALPPIATAKADFRKSSCLLYP |
| Ga0126369_126450922 | 3300012971 | Tropical Forest Soil | QKQTYAAHKLMSALPPIATKKADIGNLSCLLYPQ* |
| Ga0164305_117388541 | 3300012989 | Soil | MIRSRMSALGHKRTYAVQKSMSALPPIATAKPDISPGKCPLYPRKQT |
| Ga0157380_101510983 | 3300014326 | Switchgrass Rhizosphere | MSALGQKQTCAPQNAMSALPLIATAKADIRKRSCPLCLRKRT |
| Ga0173483_108734792 | 3300015077 | Soil | MSALGHKQTFAVQKGMSALPPIATAKADFGKPSCLLYPQ |
| Ga0132258_112277331 | 3300015371 | Arabidopsis Rhizosphere | MSALGHKRTYALQKAMSALPPIATEKADIRKRSYLL |
| Ga0132256_1018803911 | 3300015372 | Arabidopsis Rhizosphere | MSALGHKPTFALQKAMFALAQTATAKADFRAMSALL |
| Ga0132257_1018113932 | 3300015373 | Arabidopsis Rhizosphere | MSALGQKQTYAVQNVMSALHPIATEKADFRKRSCPLNPQERT |
| Ga0132257_1019028683 | 3300015373 | Arabidopsis Rhizosphere | MSALGQERTYAPQQVMSALPPIGTAKADVGNPSCLLYLRKRTCAAQ |
| Ga0132257_1036455461 | 3300015373 | Arabidopsis Rhizosphere | MSALGQKQICAAHKLMSALPPIATAKADSRKGSCPLKADMC |
| Ga0132255_1002404313 | 3300015374 | Arabidopsis Rhizosphere | MSAMGHKRTYAVQKGMSALLPIATAKADFGKPSCLLTPE |
| Ga0182036_105115561 | 3300016270 | Soil | MSALGQKQTYAVQKAMSALPPIATAKADSRKRSCLLYPQKRT |
| Ga0182033_121473361 | 3300016319 | Soil | MSALGQKQTCALQNVMSALPPIATAKADSRKGVCLLYP |
| Ga0182035_115974042 | 3300016341 | Soil | MSALGQKRTYAVHNGMSALLPKATAKADSRKGACLLY |
| Ga0182034_105197642 | 3300016371 | Soil | SALGQKQTYAVHNGMSALPPIATAKADSRKGACLLYPESGHVQCN |
| Ga0187779_109981582 | 3300017959 | Tropical Peatland | MPALGQKRTFAMQDVMSALPHIATAKADFRKRPCLLYPR |
| Ga0173482_100120415 | 3300019361 | Soil | VRLSHKQTYAMQKGMSALPLIATAKANSRKGSCLLYP |
| Ga0126371_104626502 | 3300021560 | Tropical Forest Soil | MPTMSALGQKQTYAAHKLMSALPPIATPKADSRKRPCPLYPRK |
| Ga0126371_106490661 | 3300021560 | Tropical Forest Soil | MSALGHKQTCAARNGMSALPPKATAIANFRKNHVRF |
| Ga0126371_119733552 | 3300021560 | Tropical Forest Soil | MSALGHKQTYALQNAMSALSPIATAKADLRTTSCLLYTRKQT |
| Ga0207645_100687001 | 3300025907 | Miscanthus Rhizosphere | MSALGQKQTCAPQNAMSALPLIATAKADIRKRSCPL |
| Ga0207671_107244782 | 3300025914 | Corn Rhizosphere | MSALGQKQTYALQKAMSALPPIATAKADFGNPSCLLYP |
| Ga0207671_108041551 | 3300025914 | Corn Rhizosphere | MSALGQKPTYELQQAMSALPPIATAKADMCLRSCLLYP |
| Ga0207693_106233331 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MFTEDVQMSALGQRRTYAAHKLMSAFPPIATAKADMPH |
| Ga0207662_105399911 | 3300025918 | Switchgrass Rhizosphere | MSALGQKRTYALQKAMSALPPKATAKADIRKTSCLLYLRKR |
| Ga0207650_107551102 | 3300025925 | Switchgrass Rhizosphere | MSALGRKRTYAVQKGMSALLPIATVKADSRKRSCLL |
| Ga0207690_102899542 | 3300025932 | Corn Rhizosphere | MSALGQKPTCALQNLMSALHPIATAKADIRKTPCLLYPRKRT |
| Ga0207669_100135714 | 3300025937 | Miscanthus Rhizosphere | MSALGQKQTCAPQNAMSALPLIATAKADIRKRSCPLCLRKRTCAV |
| Ga0207679_103367052 | 3300025945 | Corn Rhizosphere | MSALGQKPTCALQNLMSALHPIATAKADIRKTPCLLYPRKR |
| Ga0207712_103530881 | 3300025961 | Switchgrass Rhizosphere | MSALGQKRTYALQKATSALPPKATAKADIRKTSCLLYL |
| Ga0207668_105058562 | 3300025972 | Switchgrass Rhizosphere | MSALGQKQTYAVQEGMSALSPIATAKADFRKTSCLLAP |
| Ga0207658_109295222 | 3300025986 | Switchgrass Rhizosphere | MSALGHKQTYAVQKAMSASPLIATAKADLRKKRTCAA |
| Ga0207708_105435682 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LGHKQTFAVQKGMSALPPIATAKADFGKPSCLLYP |
| Ga0209481_103198931 | 3300027880 | Populus Rhizosphere | MSALGQKQTFALQKAMSPLPPIATVKADIRKRSCLLSLRKR |
| Ga0268265_112933632 | 3300028380 | Switchgrass Rhizosphere | MSALGQKQTCAPQKSMSALVPVATAKADMSLASCPLFPRKRT |
| Ga0268265_113837932 | 3300028380 | Switchgrass Rhizosphere | MSAWGHKQTYAPQKAMSALPRIATAKADSRKGACLPNP |
| Ga0310893_103544422 | 3300031892 | Soil | MSALGHKQTYAPQKAMSALPRIATAKADSRKGACLP |
| Ga0310916_111713452 | 3300031942 | Soil | MFALGQKQTYAVQNVMSALAPLATAKADSRKQSCPLYPQKQTC |
| Ga0310913_104225481 | 3300031945 | Soil | MSALGQKQTFASQNGMSALPPIATAKADFRKRSCL |
| Ga0310913_112507151 | 3300031945 | Soil | LHSSNPELLMSALGQKPTYAAHKGMSALPPIATAKADFGKPSCPLY |
| Ga0306922_108356212 | 3300032001 | Soil | MSALGQKQTYAVHKRMSALPPKATAKADIRESSCL |
| Ga0318504_105327892 | 3300032063 | Soil | MSALGQKQTFASQNGMSALPPIATAKADFRKRSCLLYPQKQT |
| Ga0310896_106460811 | 3300032211 | Soil | MSALGQKRTCAVQEAMSALLPIATEKADIRKTSCLLYPR |
| Ga0306920_1038460501 | 3300032261 | Soil | ALGQKQTYALQKAMSALPPIATAKADFRNRACLLCSALANVC |
| Ga0373948_0207661_2_124 | 3300034817 | Rhizosphere Soil | MSALGQKRTYAAHKSMSALPPIATAKADIGKLSCLLYPRKR |
| Ga0373958_0137755_498_602 | 3300034819 | Rhizosphere Soil | MSALGQKQTCAPQNAMSALPLIATAKADIRKRSCP |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |