NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F102669

Metagenome Family F102669

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102669
Family Type Metagenome
Number of Sequences 101
Average Sequence Length 42 residues
Representative Sequence GDEEVTTGDIVHAIGQTRRTLTPELVAEFEQDIQDYARV
Number of Associated Samples 90
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.00 %
% of genes near scaffold ends (potentially truncated) 93.07 %
% of genes from short scaffolds (< 2000 bps) 91.09 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.267 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.762 % of family members)
Environment Ontology (ENVO) Unclassified
(20.792 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.624 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.28%    β-sheet: 0.00%    Coil/Unstructured: 56.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF00106adh_short 7.92
PF00501AMP-binding 3.96
PF07311Dodecin 2.97
PF00571CBS 1.98
PF02518HATPase_c 1.98
PF07883Cupin_2 1.98
PF03976PPK2 0.99
PF00582Usp 0.99
PF13561adh_short_C2 0.99
PF00196GerE 0.99
PF00581Rhodanese 0.99
PF01734Patatin 0.99
PF12802MarR_2 0.99
PF08281Sigma70_r4_2 0.99
PF00107ADH_zinc_N 0.99
PF01641SelR 0.99
PF01243Putative_PNPOx 0.99
PF01095Pectinesterase 0.99
PF02371Transposase_20 0.99
PF14486DUF4432 0.99
PF06974WS_DGAT_C 0.99
PF06032DUF917 0.99
PF03435Sacchrp_dh_NADP 0.99
PF00378ECH_1 0.99
PF00485PRK 0.99
PF01833TIG 0.99
PF01638HxlR 0.99
PF02776TPP_enzyme_N 0.99
PF09995MPAB_Lcp_cat 0.99
PF01058Oxidored_q6 0.99
PF00082Peptidase_S8 0.99
PF00753Lactamase_B 0.99
PF00881Nitroreductase 0.99
PF00368HMG-CoA_red 0.99
PF02899Phage_int_SAM_1 0.99
PF00884Sulfatase 0.99
PF13185GAF_2 0.99
PF13411MerR_1 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG3360Flavin-binding protein dodecinGeneral function prediction only [R] 2.97
COG0229Peptide methionine sulfoxide reductase MsrBPosttranslational modification, protein turnover, chaperones [O] 0.99
COG0377NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductaseEnergy production and conversion [C] 0.99
COG1257Hydroxymethylglutaryl-CoA reductaseLipid transport and metabolism [I] 0.99
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.99
COG1740Ni,Fe-hydrogenase I small subunitEnergy production and conversion [C] 0.99
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.99
COG1941Coenzyme F420-reducing hydrogenase, gamma subunitEnergy production and conversion [C] 0.99
COG2326Polyphosphate kinase 2, PPK2 familyEnergy production and conversion [C] 0.99
COG3260Ni,Fe-hydrogenase III small subunitEnergy production and conversion [C] 0.99
COG3535Uncharacterized conserved protein, DUF917 familyFunction unknown [S] 0.99
COG3547TransposaseMobilome: prophages, transposons [X] 0.99
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.99
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.99
COG4677Pectin methylesterase and related acyl-CoA thioesterasesCarbohydrate transport and metabolism [G] 0.99
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.99
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.27 %
UnclassifiedrootN/A26.73 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459010|GIO7OMY02HPRZVNot Available512Open in IMG/M
3300005332|Ga0066388_104702734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia695Open in IMG/M
3300005434|Ga0070709_10505693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae918Open in IMG/M
3300005434|Ga0070709_10718573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia778Open in IMG/M
3300005435|Ga0070714_100901632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia858Open in IMG/M
3300005435|Ga0070714_101382343Not Available687Open in IMG/M
3300005471|Ga0070698_101954965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia vinacea540Open in IMG/M
3300005542|Ga0070732_10980803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales517Open in IMG/M
3300006034|Ga0066656_11027627All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300006102|Ga0075015_100284341Not Available905Open in IMG/M
3300006893|Ga0073928_11065787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia548Open in IMG/M
3300006954|Ga0079219_12422119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300009029|Ga0066793_10168261Not Available1277Open in IMG/M
3300009522|Ga0116218_1243812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia808Open in IMG/M
3300009792|Ga0126374_11379228Not Available573Open in IMG/M
3300010364|Ga0134066_10364021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae540Open in IMG/M
3300010376|Ga0126381_104368723Not Available547Open in IMG/M
3300010379|Ga0136449_103417658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis607Open in IMG/M
3300010398|Ga0126383_12423660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia610Open in IMG/M
3300012201|Ga0137365_11119743Not Available566Open in IMG/M
3300012207|Ga0137381_10841569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer794Open in IMG/M
3300012351|Ga0137386_10246946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1283Open in IMG/M
3300012363|Ga0137390_10086661All Organisms → cellular organisms → Bacteria3085Open in IMG/M
3300012683|Ga0137398_10718913All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300012927|Ga0137416_10895334All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300013308|Ga0157375_10708517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1160Open in IMG/M
3300014150|Ga0134081_10424819Not Available503Open in IMG/M
3300015245|Ga0137409_10319339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium1361Open in IMG/M
3300015371|Ga0132258_10342445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3694Open in IMG/M
3300016270|Ga0182036_10923453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia716Open in IMG/M
3300016270|Ga0182036_11476244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia570Open in IMG/M
3300016341|Ga0182035_11112345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae703Open in IMG/M
3300016357|Ga0182032_10936774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia737Open in IMG/M
3300016387|Ga0182040_11416016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia589Open in IMG/M
3300017924|Ga0187820_1055570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1077Open in IMG/M
3300017926|Ga0187807_1298931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M
3300017942|Ga0187808_10218219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria850Open in IMG/M
3300017961|Ga0187778_10224119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1202Open in IMG/M
3300017995|Ga0187816_10583174Not Available503Open in IMG/M
3300018001|Ga0187815_10390544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia592Open in IMG/M
3300018012|Ga0187810_10411667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300018012|Ga0187810_10519039Not Available510Open in IMG/M
3300018032|Ga0187788_10556539Not Available502Open in IMG/M
3300020580|Ga0210403_11067623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia629Open in IMG/M
3300021181|Ga0210388_11226832Not Available635Open in IMG/M
3300021402|Ga0210385_11026417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia634Open in IMG/M
3300021403|Ga0210397_10980828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae655Open in IMG/M
3300021404|Ga0210389_10549325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia908Open in IMG/M
3300021406|Ga0210386_11253229Not Available625Open in IMG/M
3300021477|Ga0210398_10447866All Organisms → cellular organisms → Bacteria → Terrabacteria group1052Open in IMG/M
3300021479|Ga0210410_10751472All Organisms → cellular organisms → Bacteria → Terrabacteria group859Open in IMG/M
3300021559|Ga0210409_11562131Not Available536Open in IMG/M
3300024288|Ga0179589_10028011All Organisms → cellular organisms → Bacteria1948Open in IMG/M
3300025527|Ga0208714_1007418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces griseochromogenes2919Open in IMG/M
3300025898|Ga0207692_10050900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2097Open in IMG/M
3300025898|Ga0207692_10215736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1135Open in IMG/M
3300025910|Ga0207684_10083142All Organisms → cellular organisms → Bacteria2727Open in IMG/M
3300025915|Ga0207693_10466058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer → Ktedonobacter racemifer DSM 44963987Open in IMG/M
3300025915|Ga0207693_11064991All Organisms → cellular organisms → Bacteria → Terrabacteria group615Open in IMG/M
3300025916|Ga0207663_10040504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2832Open in IMG/M
3300025916|Ga0207663_11090220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium pseudokansasii642Open in IMG/M
3300025939|Ga0207665_10366036All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300026075|Ga0207708_11803910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300026088|Ga0207641_10376917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1358Open in IMG/M
3300026551|Ga0209648_10699852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia553Open in IMG/M
3300026557|Ga0179587_10478548Not Available816Open in IMG/M
3300027765|Ga0209073_10209878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces guanduensis743Open in IMG/M
3300027787|Ga0209074_10091034Not Available1015Open in IMG/M
3300027915|Ga0209069_10995958All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus → Chthoniobacter flavus Ellin428514Open in IMG/M
3300028536|Ga0137415_11037911All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium632Open in IMG/M
3300028879|Ga0302229_10401599Not Available609Open in IMG/M
3300030509|Ga0302183_10231146Not Available720Open in IMG/M
3300030743|Ga0265461_10019325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1905Open in IMG/M
3300031027|Ga0302308_10843174All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300031572|Ga0318515_10202370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1064Open in IMG/M
3300031668|Ga0318542_10701750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia529Open in IMG/M
3300031708|Ga0310686_117159699Not Available505Open in IMG/M
3300031713|Ga0318496_10685837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300031715|Ga0307476_10217352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora pinisilvae1390Open in IMG/M
3300031765|Ga0318554_10288801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia933Open in IMG/M
3300031768|Ga0318509_10604251All Organisms → cellular organisms → Bacteria → Terrabacteria group611Open in IMG/M
3300031770|Ga0318521_10387238Not Available832Open in IMG/M
3300031770|Ga0318521_11045659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae501Open in IMG/M
3300031778|Ga0318498_10539196Not Available512Open in IMG/M
3300031805|Ga0318497_10292506Not Available907Open in IMG/M
3300031823|Ga0307478_10666035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora pinisilvae871Open in IMG/M
3300031897|Ga0318520_10884863All Organisms → cellular organisms → Bacteria → Terrabacteria group562Open in IMG/M
3300031912|Ga0306921_11551081All Organisms → cellular organisms → Bacteria → Terrabacteria group722Open in IMG/M
3300032001|Ga0306922_11328712Not Available726Open in IMG/M
3300032008|Ga0318562_10903155Not Available504Open in IMG/M
3300032055|Ga0318575_10478046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia633Open in IMG/M
3300032059|Ga0318533_10156337Not Available1616Open in IMG/M
3300032064|Ga0318510_10152764Not Available912Open in IMG/M
3300032770|Ga0335085_10572958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer → Ktedonobacter racemifer DSM 449631275Open in IMG/M
3300032805|Ga0335078_10596096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Phytoactinopolyspora → Phytoactinopolyspora endophytica1395Open in IMG/M
3300032828|Ga0335080_10377408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1525Open in IMG/M
3300032898|Ga0335072_10142173All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Rhodothermus2962Open in IMG/M
3300032898|Ga0335072_10279499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1890Open in IMG/M
3300033134|Ga0335073_10193789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2530Open in IMG/M
3300033134|Ga0335073_11649158All Organisms → cellular organisms → Bacteria → Terrabacteria group609Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.90%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment6.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.97%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.97%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.98%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.98%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.99%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.99%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.99%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.99%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.99%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_090376002170459010Grass SoilRGQEQVTTGDVLRAVGQTRRTLTAELVAEFEQDIQDYARV
Ga0066388_10470273423300005332Tropical Forest SoilRVMFEGGEQEVTTSDIRYAISKTRRTLTSELVAEFEQDIQDHARL*
Ga0070709_1050569333300005434Corn, Switchgrass And Miscanthus RhizosphereHGKELVTTDDIRHAISQTRRTLTPELVADFEQDITEYARK*
Ga0070709_1071857333300005434Corn, Switchgrass And Miscanthus RhizosphereHGKELVTTDDIRHAISQTRRTLTPELVADFEQDITEYARI*
Ga0070714_10090163223300005435Agricultural SoilVLFEHGKEEVTTADVLQGIAETRRTLTAELVADFEQDIKDYARV*
Ga0070714_10138234323300005435Agricultural SoilFEGGEQEVTTSDIRHAISKTRRTLTPELVAEFEQDIEDYARV*
Ga0070698_10195496513300005471Corn, Switchgrass And Miscanthus RhizosphereGDEEVTTGDIVHAIGQTRRTLTPELVAEFEQDIQDYARV*
Ga0070732_1098080323300005542Surface SoilERVLFERGEEKVSTADVLCGIAETRRTLTPELVAEFEQDIQAYARV*
Ga0066656_1102762713300006034SoilFERVLFEHGKELVTTGDIRHAISQTRRTLTPELVADFEQDITEYARM*
Ga0075015_10028434113300006102WatershedsAQLVFERVMFEHGAEETTTADIVHAISQTRRTLTSPLVSDFEQDIKDYARV*
Ga0073928_1106578723300006893Iron-Sulfur Acid SpringGEEEVTTGDILHAIGQTRRTLTPGLVAEFEQDIKDYARV*
Ga0079219_1242211923300006954Agricultural SoilVIFTLMTDDIRHAISQTRRTLTPELVADFEQDITEYARI*
Ga0066793_1016826123300009029Prmafrost SoilMFEGGEQEVTTSDIRHAIGKTRRTLTPELVAEFEQDIEDYSRA*
Ga0116218_124381223300009522Peatlands SoilEAATADIMHAIGQTRRTLTPELVAEFEQDIQDHARV*
Ga0126374_1137922813300009792Tropical Forest SoilDQAPSRSRPSAGPEPEEASTADLVHAISQTRRTLTPELAAELEQDIQDHARV*
Ga0134066_1036402123300010364Grasslands SoilEHGKELVTTGDIRHAISQTRRTLTPELVAEFEQDITEYARI*
Ga0126381_10110934013300010376Tropical Forest SoilHGEELTTTADVVRGIGQTRRTLTTEMVAQFEQDIKDYARL*
Ga0126381_10436872313300010376Tropical Forest SoilFERVLFERGAEEVTTEDVRHAIDQTRRTLTAELVAEFEQDIQDHARV*
Ga0136449_10341765813300010379Peatlands SoilRTAQLAFERVLFEHGTEEVTTGDVLHAIGQTRRTLTAEVVAQFEQDILDYARV*
Ga0126383_1242366023300010398Tropical Forest SoilRPSAGPEPEEATTADLVHAISQTRRTLTPELAAELEQDIQDHARV*
Ga0137365_1111974313300012201Vadose Zone SoilVLFEHGKELVTTGDIRHAISQTRRTLTSELVAEFEQDITEYARM*
Ga0137381_1084156923300012207Vadose Zone SoilTTADVLRGIAETRRTLTPELVAEFEQDIQAYARV*
Ga0137386_1024694613300012351Vadose Zone SoilEEATTADIVHAIGQTRRTLTPELVAEFEQDIQDHARV*
Ga0137390_1008666113300012363Vadose Zone SoilGEELTSTPDVLRGLAETRRTLTPETVAEFEQDIKDYSRL*
Ga0137398_1071891333300012683Vadose Zone SoilLAFERVLFEHGKELVTTGDIRHAISQTRRTLTPELVAEFEQDITEYARMLGLGTSWLAE*
Ga0137416_1089533413300012927Vadose Zone SoilRVLFEHGKELVTTGDIRHAISQTRRTLTAEVVAEFEQDITEYARMLGLGTSWLAE*
Ga0157375_1070851733300013308Miscanthus RhizosphereFERVLFERGKELVTTGDIRHAISQTRRTLTPELVADFEQDITEYARI*
Ga0134081_1042481923300014150Grasslands SoilLFEHGKELVTTGDIRHAISQTRRTLTPELVAEFEQDITEYARI*
Ga0137409_1031933913300015245Vadose Zone SoilKEVVTTGDIRHAISQTRRTLTPELVAEFEQDITEYARM*
Ga0132258_1034244543300015371Arabidopsis RhizosphereGKELVTTDDIRHAISQTRRTLTPELVADFEQDITEYARI*
Ga0182036_1092345313300016270SoilEAVTTADVLQGIGQTRRTLTPELVAEFEQDIQAYARV
Ga0182036_1147624423300016270SoilVLFERGKEEVTTADVLRGITETRRTLTPEAVTEFEQDIQAYARV
Ga0182035_1111234523300016341SoilVLFERGKDEVTTADVLRGIAETRRTLTAEVVAEFEQDIQAYARV
Ga0182032_1093677433300016357SoilEHGTEQAATADIVHAIGQTRPTLTAELVTEFEQDIKDYARV
Ga0182040_1141601613300016387SoilHGTEQAATADIVHAIGQTRPTLTAELVTEFEQDIKDYARV
Ga0187820_105557013300017924Freshwater SedimentAARRTAQLVFERVMFERGADQAATPDIEHAISQTRRTLTDELVTDFEQDIKDYARV
Ga0187807_129893113300017926Freshwater SedimentGAEQAATADIVHAISQTRRTLTADLVADFEQDIKHYGRV
Ga0187808_1021821913300017942Freshwater SedimentLAFERVLFEGGGEEVATGDILHAIGQTRRTLTPELVSEFEQDIQDYARV
Ga0187778_1022411913300017961Tropical PeatlandMFDHGGELAATADIVHAIGQTRRTLTKEPVTEFEQDINDYARV
Ga0187816_1058317413300017995Freshwater SedimentGEEQVTTDDVRKAIAMTRRTLTPELVAEFEQDIEDYARA
Ga0187815_1039054413300018001Freshwater SedimentGADQAATPDIEHAISQTRRTLTDELVTDFEQDIKDYARV
Ga0187810_1041166713300018012Freshwater SedimentGGGEEVATADILHAIGQTRRTLTPELVSEFEQDIQDYARV
Ga0187810_1051903923300018012Freshwater SedimentEVATADILHAIGQTRRTLTPELVSEFEQDIQDYARV
Ga0187788_1055653923300018032Tropical PeatlandRGEEEVTTGDILHAIGQTRRTLTPELVAEFEQDIEDYARV
Ga0210403_1106762323300020580SoilVLFQRGEEQVTTGDVLRAVGQTRRTLTAELVKEFEQDIQNYARV
Ga0210388_1122683223300021181SoilERGAEEATTADIVHGIGQTRRTLTPELVAEFEQDIQDHARV
Ga0210385_1102641723300021402SoilLFERGEEQVTMTDIRQAIAKTRRTLTPELVADFEQDIEDYARV
Ga0210397_1098082813300021403SoilQVTTGDVLRAVGQTRRTLTAELVAEFEQDIQDYARV
Ga0210389_1054932513300021404SoilVTTGDVLRAVGQTRRTLTPELVAEFEQDIQAYARV
Ga0210386_1125322923300021406SoilFERGAEEATTADIVHGIGQTRRTLTPELVAEFEQDIQDHARV
Ga0210398_1044786613300021477SoilQRGEEQVTTGDVLRAVGQTRRTLTAELVAEFEQDIQDYARV
Ga0210410_1075147213300021479SoilHGQEQVTTGDVLRAVGQTRRTLTPELVAEFEQDIQAYARV
Ga0210409_1156213113300021559SoilERVMFERGAEEATTADIVHGIGQTRRTLTPELVAEFEQDIQDHARV
Ga0179589_1002801113300024288Vadose Zone SoilGKELVTTGDIRHAISHTRRTLTPELVAEFEQDITEYARM
Ga0208714_100741813300025527Arctic Peat SoilERGAEEATTADIMHAIGQTRRTLTPELVAEFEQDIQDHARV
Ga0207692_1005090043300025898Corn, Switchgrass And Miscanthus RhizosphereGKEEVTTADVLQGIAETRRTLTAELVADFEQDIKDYARV
Ga0207692_1021573613300025898Corn, Switchgrass And Miscanthus RhizosphereRGEEQVTTGDVLRAVGQTRRTLTAELVDEFEQDIQDYARV
Ga0207684_1008314233300025910Corn, Switchgrass And Miscanthus RhizosphereVFIDEVEEILCGIAETRRTLTPELVVEFEQDIQAYARV
Ga0207693_1046605823300025915Corn, Switchgrass And Miscanthus RhizosphereLFEHGKEEVTTADVLQGIAETRRTLTAELVTDFEQDIEAYARV
Ga0207693_1106499113300025915Corn, Switchgrass And Miscanthus RhizosphereEEVTTADVLQGIAETRRTLTAELVADFEQDIKDYARV
Ga0207663_1004050413300025916Corn, Switchgrass And Miscanthus RhizosphereERVLFEHGKEEVTTADVLQGIAETRRTLTAELVADFEQDIKDYARV
Ga0207663_1109022013300025916Corn, Switchgrass And Miscanthus RhizosphereHGKEEVTTADVLRGIAETRRTLTAELVADFEQDIEAYARV
Ga0207665_1036603633300025939Corn, Switchgrass And Miscanthus RhizosphereVTTADVLQGIAETRRTLTAELVADFEQDIKDYARV
Ga0207708_1180391023300026075Corn, Switchgrass And Miscanthus RhizosphereKELVTTDDIRHAISQTRRTLTPELVADFEQDITEYARI
Ga0207641_1037691733300026088Switchgrass RhizosphereGKEEVTTADVLAGIAETRRTLTAELVADFEQDIKDYARV
Ga0209648_1069985223300026551Grasslands SoilQDLTTTTDVLRGIAQTRRTLTPEMVAEFEQDIQDYARL
Ga0179587_1047854813300026557Vadose Zone SoilQVTTGDVLRAVGQTRRTLTPELVAEFEQDIQAYARV
Ga0209073_1020987813300027765Agricultural SoilAFERVLFEHGKEEVTTADVLQGIAETRRTLTAELVADFEQDIKDYARV
Ga0209074_1009103413300027787Agricultural SoilVIFTLMTDDIRHAISQTRRTLTPELVADFEQDITEYARI
Ga0209069_1099595813300027915WatershedsMFEHGAEEATTADIAHAISQTRRTLTPELVAEFEQDIQNYARV
Ga0137415_1103791113300028536Vadose Zone SoilRVLFEHGKELVTTGDIRHAISQTRRTLTAEVVAEFEQDITEYARMLGLGTSWLAE
Ga0302229_1040159923300028879PalsaLFEHGDEELTTADILRAIGQTRRTLTTELVSEFEQDIHDYARV
Ga0302183_1023114623300030509PalsaQGDEELTSGDILRAIGQTRRTLTTELVSEFEQDILDYARV
Ga0265461_1001932553300030743SoilFERVLFEHGDEEVTTGDVLHAIGQTRRTLTAELVAEFEQDILDYARV
Ga0302308_1084317413300031027PalsaVTTGDVLHAVGQTRRTLTLELVTEFEQDIQDYARV
Ga0318515_1020237013300031572SoilRVLFERGEEEVTTADVLHGIGQTRRTLTPELVAEFEQDIQAYARV
Ga0318542_1070175013300031668SoilVTTSDILHAIGQTRRTLTPELVAEFEQDIQDYARI
Ga0310686_11715969923300031708SoilRVLFEHGDEEVTTGDVLHAIGQTRRTLTTELVAEFEQDILDYSRV
Ga0318496_1068583713300031713SoilGEEEVTTADVLHGIGQTRRTLTPELVAEFEQDIQAYARV
Ga0307476_1021735213300031715Hardwood Forest SoilVLFEHGEEQVTTGDVLRAVGLTRRTLTPELVAEFEQDIQAYARV
Ga0318554_1028880113300031765SoilGAEEATTADLVHAIGQTRRTLTPQLVAEFEQDIQDYARV
Ga0318509_1060425123300031768SoilFEGGGEQVTTGDVLHAIGQTRRTLTPELVAEFEQDIQDYARV
Ga0318521_1038723813300031770SoilLNSSGVLFEHGDEAVTTGDVLDPIGQTRRTPTPELMAEFEQDIHDYARV
Ga0318521_1104565913300031770SoilVRRVLFERGKEEVTTADVLRGITETRRTLTPEAVAEFEQDIQAFARI
Ga0318498_1053919623300031778SoilLFEGGGEEVATGDVLHAIGQTRRTLTPELVAEFEQDIQDYARV
Ga0318497_1029250623300031805SoilEVTTGDILHAIGQTRRTLTPELVAEFEQDIQDYARV
Ga0307478_1066603513300031823Hardwood Forest SoilEEQVTTGDVLRAVGLTRRTLTPELVAEFEQDIQAYARV
Ga0318520_1088486323300031897SoilHWWQSRRRGGEDVTTSDILHAIGQTRRTLTPELVAEFEQDIQDYARI
Ga0306921_1155108123300031912SoilGHWWQSRRRGGEDVTTSDILHAIGQTRRTLTPELVAEFEQDIQDYARI
Ga0306922_1132871213300032001SoilRVLFEGGGEEVATGDVLHAIGQTRRTLTPELVAEFEQDIQDYARV
Ga0318562_1090315523300032008SoilGAEEATTADLVHAIGQTRRTLTPELVAEFEQDIQDYARV
Ga0318575_1047804623300032055SoilRVLFEGGGEEVTTGDVLHAIGQTRRTLTPELVAEFEQDITDYARV
Ga0318533_1015633713300032059SoilFEGGEQEVTTSDVRHAISKTRRTLTPELVAKFEQDIQDHARV
Ga0318510_1015276423300032064SoilQLAFERVMFEGGEQEVTTSDVRHAISKTRRTLTPELVAKFEQDIQDHARV
Ga0335085_1057295813300032770SoilVTTADVLQGIAETRRTLTAELVADFEQDIEDYARV
Ga0335078_1059609653300032805SoilERVLFERGDEDVTTADVLEGIAQTRRTLTPELVAEFEQDIQAYARV
Ga0335080_1037740833300032828SoilQLAFEQVLFEGGGEEVATGDVLHAIGQTRRTLTPELVSEFEQDIQDYARV
Ga0335072_1014217313300032898SoilVTTGDIRHAISQTRRTLTAEVVADFEQDITEYARI
Ga0335072_1027949953300032898SoilLFERGEQQVTTDDVLHAVGQTRRTLTAELVADFEQDIQDYARV
Ga0335073_1019378913300033134SoilDVTTADVLEGIAQTRRTLTPELVAEFEQDIQAYARV
Ga0335073_1164915813300033134SoilAETATTADVLAGLSQTRRTLTPEMVTQFEQDISSYARV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.