Basic Information | |
---|---|
Family ID | F102438 |
Family Type | Metagenome |
Number of Sequences | 101 |
Average Sequence Length | 42 residues |
Representative Sequence | MFDFTKQTKQYEELAQRIKEVNEFWINSIFSSAKEFFKVK |
Number of Associated Samples | 73 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 91.18 % |
% of genes near scaffold ends (potentially truncated) | 7.92 % |
% of genes from short scaffolds (< 2000 bps) | 61.39 % |
Associated GOLD sequencing projects | 65 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (69.307 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (32.673 % of family members) |
Environment Ontology (ENVO) | Unclassified (70.297 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (88.119 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF03237 | Terminase_6N | 15.84 |
PF00583 | Acetyltransf_1 | 1.98 |
PF01844 | HNH | 1.98 |
PF11753 | DUF3310 | 0.99 |
PF10124 | Mu-like_gpT | 0.99 |
PF01612 | DNA_pol_A_exo1 | 0.99 |
PF10263 | SprT-like | 0.99 |
PF16190 | E1_FCCH | 0.99 |
PF10926 | DUF2800 | 0.99 |
PF00959 | Phage_lysozyme | 0.99 |
PF05866 | RusA | 0.99 |
PF00271 | Helicase_C | 0.99 |
PF12705 | PDDEXK_1 | 0.99 |
PF06048 | DUF927 | 0.99 |
COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
---|---|---|---|
COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.99 |
COG5519 | Predicted ATPase domain of Cch-like helicases, DUF927 family | General function prediction only [R] | 0.99 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 69.31 % |
All Organisms | root | All Organisms | 30.69 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000162|TB03JUN2009H_c018593 | Not Available | 808 | Open in IMG/M |
3300000553|TBL_comb47_HYPODRAFT_10118143 | Not Available | 1242 | Open in IMG/M |
3300000553|TBL_comb47_HYPODRAFT_10127866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1164 | Open in IMG/M |
3300001842|RCM30_1052794 | Not Available | 544 | Open in IMG/M |
3300002091|JGI24028J26656_1000399 | Not Available | 14274 | Open in IMG/M |
3300002091|JGI24028J26656_1000615 | Not Available | 10348 | Open in IMG/M |
3300002091|JGI24028J26656_1001213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6079 | Open in IMG/M |
3300002091|JGI24028J26656_1003915 | All Organisms → cellular organisms → Bacteria | 2425 | Open in IMG/M |
3300002092|JGI24218J26658_1000992 | Not Available | 10234 | Open in IMG/M |
3300002197|metazooDRAFT_1206516 | Not Available | 520 | Open in IMG/M |
3300003375|JGI26470J50227_1006110 | Not Available | 3285 | Open in IMG/M |
3300003375|JGI26470J50227_1029343 | Not Available | 1109 | Open in IMG/M |
3300003804|Ga0007817_1006989 | Not Available | 790 | Open in IMG/M |
3300003823|Ga0007875_1007067 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1435 | Open in IMG/M |
3300003852|Ga0031655_10309346 | Not Available | 590 | Open in IMG/M |
3300004448|Ga0065861_1012783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 5710 | Open in IMG/M |
3300004461|Ga0066223_1056361 | Not Available | 604 | Open in IMG/M |
3300004804|Ga0007796_10055211 | Not Available | 1298 | Open in IMG/M |
3300004804|Ga0007796_10214742 | Not Available | 563 | Open in IMG/M |
3300004805|Ga0007792_10077587 | Not Available | 1009 | Open in IMG/M |
3300006037|Ga0075465_10055180 | Not Available | 844 | Open in IMG/M |
3300009068|Ga0114973_10013019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5306 | Open in IMG/M |
3300009068|Ga0114973_10018112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 4414 | Open in IMG/M |
3300009151|Ga0114962_10595153 | Not Available | 574 | Open in IMG/M |
3300009152|Ga0114980_10133817 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1473 | Open in IMG/M |
3300009152|Ga0114980_10210507 | Not Available | 1142 | Open in IMG/M |
3300009152|Ga0114980_10319590 | Not Available | 899 | Open in IMG/M |
3300009155|Ga0114968_10007067 | Not Available | 8239 | Open in IMG/M |
3300009160|Ga0114981_10123065 | Not Available | 1435 | Open in IMG/M |
3300009164|Ga0114975_10386080 | Not Available | 766 | Open in IMG/M |
3300009175|Ga0073936_10118629 | Not Available | 2089 | Open in IMG/M |
3300009184|Ga0114976_10019479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4149 | Open in IMG/M |
3300009502|Ga0114951_10525773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300010158|Ga0114960_10011729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5957 | Open in IMG/M |
3300010158|Ga0114960_10032142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3263 | Open in IMG/M |
3300010334|Ga0136644_10624271 | Not Available | 591 | Open in IMG/M |
3300010885|Ga0133913_10000852 | Not Available | 68379 | Open in IMG/M |
3300010885|Ga0133913_10361491 | Not Available | 3839 | Open in IMG/M |
3300010885|Ga0133913_10565229 | Not Available | 2990 | Open in IMG/M |
3300010885|Ga0133913_10754748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2540 | Open in IMG/M |
3300010885|Ga0133913_10761699 | Not Available | 2527 | Open in IMG/M |
3300010885|Ga0133913_11268815 | All Organisms → Viruses → Predicted Viral | 1884 | Open in IMG/M |
3300010885|Ga0133913_12685584 | Not Available | 1205 | Open in IMG/M |
3300010885|Ga0133913_13215632 | All Organisms → Viruses → Predicted Viral | 1079 | Open in IMG/M |
3300012346|Ga0157141_1000541 | Not Available | 10961 | Open in IMG/M |
3300013093|Ga0164296_1002782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 17027 | Open in IMG/M |
3300013285|Ga0136642_1014804 | Not Available | 2346 | Open in IMG/M |
3300013285|Ga0136642_1031155 | Not Available | 1516 | Open in IMG/M |
3300013286|Ga0136641_1076144 | Not Available | 951 | Open in IMG/M |
3300014711|Ga0134314_110025 | Not Available | 621 | Open in IMG/M |
3300014811|Ga0119960_1000220 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1474 | Open in IMG/M |
3300014962|Ga0134315_1019876 | Not Available | 1042 | Open in IMG/M |
3300015050|Ga0181338_1013489 | Not Available | 1319 | Open in IMG/M |
3300017722|Ga0181347_1001005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9404 | Open in IMG/M |
3300017754|Ga0181344_1007433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3606 | Open in IMG/M |
3300017754|Ga0181344_1028183 | Not Available | 1722 | Open in IMG/M |
3300017754|Ga0181344_1037737 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1463 | Open in IMG/M |
3300017754|Ga0181344_1052846 | Not Available | 1211 | Open in IMG/M |
3300017754|Ga0181344_1071329 | Not Available | 1024 | Open in IMG/M |
3300017754|Ga0181344_1130411 | Not Available | 722 | Open in IMG/M |
3300017766|Ga0181343_1054902 | All Organisms → Viruses → Predicted Viral | 1165 | Open in IMG/M |
3300017766|Ga0181343_1118731 | Not Available | 745 | Open in IMG/M |
3300020141|Ga0211732_1249033 | Not Available | 794 | Open in IMG/M |
3300020157|Ga0194049_1057214 | Not Available | 1020 | Open in IMG/M |
3300020164|Ga0194037_1001893 | Not Available | 14536 | Open in IMG/M |
3300020205|Ga0211731_10434584 | All Organisms → Viruses → Predicted Viral | 4281 | Open in IMG/M |
3300020205|Ga0211731_10927810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 2805 | Open in IMG/M |
3300020686|Ga0214194_100283 | Not Available | 8861 | Open in IMG/M |
3300020688|Ga0214239_100322 | Not Available | 8479 | Open in IMG/M |
3300021354|Ga0194047_10358131 | Not Available | 550 | Open in IMG/M |
3300021519|Ga0194048_10375565 | Not Available | 504 | Open in IMG/M |
3300021962|Ga0222713_10732000 | Not Available | 560 | Open in IMG/M |
3300021963|Ga0222712_10263100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1098 | Open in IMG/M |
3300022190|Ga0181354_1074080 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
3300022555|Ga0212088_10133931 | Not Available | 2146 | Open in IMG/M |
3300022592|Ga0236342_1094802 | Not Available | 607 | Open in IMG/M |
3300023311|Ga0256681_12367643 | Not Available | 936 | Open in IMG/M |
3300025316|Ga0209697_10109014 | Not Available | 1814 | Open in IMG/M |
3300025372|Ga0207957_1007391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1628 | Open in IMG/M |
3300025383|Ga0208250_1000700 | Not Available | 9213 | Open in IMG/M |
3300025383|Ga0208250_1047749 | Not Available | 628 | Open in IMG/M |
3300025606|Ga0207954_1074543 | Not Available | 874 | Open in IMG/M |
3300025778|Ga0208388_1033624 | Not Available | 771 | Open in IMG/M |
3300025896|Ga0208916_10076012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1402 | Open in IMG/M |
3300027708|Ga0209188_1036173 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2311 | Open in IMG/M |
3300027708|Ga0209188_1285429 | Not Available | 555 | Open in IMG/M |
3300027734|Ga0209087_1040352 | Not Available | 2184 | Open in IMG/M |
3300027754|Ga0209596_1159021 | Not Available | 998 | Open in IMG/M |
3300027760|Ga0209598_10001021 | Not Available | 22773 | Open in IMG/M |
3300027763|Ga0209088_10002193 | Not Available | 12148 | Open in IMG/M |
3300027777|Ga0209829_10076491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1680 | Open in IMG/M |
3300027777|Ga0209829_10231170 | Not Available | 788 | Open in IMG/M |
3300027896|Ga0209777_11187403 | Not Available | 510 | Open in IMG/M |
3300027969|Ga0209191_1245507 | Not Available | 684 | Open in IMG/M |
3300027971|Ga0209401_1024421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3011 | Open in IMG/M |
3300027973|Ga0209298_10115216 | Not Available | 1160 | Open in IMG/M |
3300027974|Ga0209299_1072972 | Not Available | 1383 | Open in IMG/M |
3300031759|Ga0316219_1000551 | All Organisms → cellular organisms → Bacteria | 50133 | Open in IMG/M |
3300031999|Ga0315274_10177974 | Not Available | 2665 | Open in IMG/M |
3300034013|Ga0334991_0000191 | Not Available | 65428 | Open in IMG/M |
3300034060|Ga0334983_0137917 | Not Available | 1551 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 32.67% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 11.88% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.89% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.91% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 4.95% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 4.95% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 3.96% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.97% |
Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 2.97% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.98% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 1.98% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.98% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.98% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.98% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.99% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.99% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.99% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.99% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.99% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000162 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
3300002197 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - DEC 2012 | Environmental | Open in IMG/M |
3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
3300003804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 | Environmental | Open in IMG/M |
3300003823 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 | Environmental | Open in IMG/M |
3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012346 | Freshwater microbial communities from Emily Creek, Ontario, Canada - S29 | Environmental | Open in IMG/M |
3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300014711 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020157 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25m | Environmental | Open in IMG/M |
3300020164 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L304-6m | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020686 | Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 epilimnion | Environmental | Open in IMG/M |
3300020688 | Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 hypolimnion | Environmental | Open in IMG/M |
3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
3300022592 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S3 | Environmental | Open in IMG/M |
3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
3300025316 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes) | Environmental | Open in IMG/M |
3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025606 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes) | Environmental | Open in IMG/M |
3300025778 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
TB03JUN2009H_0185932 | 3300000162 | Freshwater | MIQVEKYFKQYEELVERIKDVNEFWLNSVLSATKEFFKTQKTK* |
TBL_comb47_HYPODRAFT_101181433 | 3300000553 | Freshwater | MFEFEKAYKQYEELVSRVKDVNEFWINSVFYSVKEFFNITKTK* |
TBL_comb47_HYPODRAFT_101278663 | 3300000553 | Freshwater | MFDFEKPFKQYEELVERVRQVNEFWLQSTLSTIKEFFKIVKTK* |
RCM30_10527941 | 3300001842 | Marine Plankton | MFTQYEKANKQYEELVERIKEVNEFWINSVLSSTKEFFKTIKTK* |
JGI24028J26656_100039913 | 3300002091 | Lentic | MFDFSKQTKQYEELAERIKEINEFWINFITSSLKQFTK* |
JGI24028J26656_100061512 | 3300002091 | Lentic | MFDFVKVTKQYEELAERIKEVNEFWINSVISSLKQLVK* |
JGI24028J26656_10012135 | 3300002091 | Lentic | MFDFEKPYKQYEELLVRIKDVNEFWINSVFYSIKEFFKIK* |
JGI24028J26656_10039154 | 3300002091 | Lentic | MFDFEKPFKQYEELVERIKEVNEFWINSVFSSAKEFFKLKK* |
JGI24218J26658_10009923 | 3300002092 | Lentic | MFDFEKQYKQYEELAERIKEVNEFWINSVLSATKEFFKVAKSK* |
metazooDRAFT_12065161 | 3300002197 | Lake | MYANFEKAFKQYEELTERVKEVNEFWINSVLSSLKAFYSTSKK* |
JGI26470J50227_10061102 | 3300003375 | Freshwater | MFEFEKPFKQYEELVERVKEVNEFWVNSVFSSVKEFFKIK* |
JGI26470J50227_10293432 | 3300003375 | Freshwater | MFDFEKPYKQYEELVERVRQVNEFWLNSVFYSIKEFFKIK* |
Ga0007817_10069891 | 3300003804 | Freshwater | MFDFEKPFKQYEELVERVRQVNEFWLQSTLSTIKEFFKIVKTK |
Ga0007875_10070673 | 3300003823 | Freshwater | MFEFDKAYKQYEELVERVKEVNEFWINSVFSSVKEFFKVK* |
Ga0031655_103093462 | 3300003852 | Freshwater Lake Sediment | MFDFEKPFKQYEELVERVKEVNEFWLQSTLSTIKEFFKIVKTK* |
Ga0065861_10127835 | 3300004448 | Marine | MFDFTKQTKQFEELAQRIKDVNDFWIDAFVSSIKEFTKTK* |
Ga0066223_10563611 | 3300004461 | Marine | MFDFTKQTKQFEQLAERIKEVNEFWVNAVMSTWKDLYEARKK* |
Ga0007796_100552112 | 3300004804 | Freshwater | MIQIEKHIKQYEELAKRIQEVNEFWINSVLASTKEFFNTSKTK* |
Ga0007796_102147421 | 3300004804 | Freshwater | MIDFGYEKAYKQYEELVERLKEVNDFWINSVLSTTKEFFKSIKTK* |
Ga0007792_100775871 | 3300004805 | Freshwater | MFNTDFEKQYKEATKQYEELAQRIKEVNEFWINSVISSLKQFTK* |
Ga0075465_100551801 | 3300006037 | Aqueous | MKGNTMFDFTKQTKQYEELAKRIQEVNEFWVNAVISSLKQFIK* |
Ga0114973_100130193 | 3300009068 | Freshwater Lake | MFDFTKQTKQFEQLAERIKEVNEFWINAFVSSIKQFTK* |
Ga0114973_100181123 | 3300009068 | Freshwater Lake | MFDFTKQTKQFEQLAERIKEVNDFWIDAFISSIKQFTK* |
Ga0114962_105951531 | 3300009151 | Freshwater Lake | MFDFTKQTKQFEELAQRIKDVNDFWIDAFISSIKQFTK* |
Ga0114980_101338171 | 3300009152 | Freshwater Lake | MEKTMFEFEKQFKQYEELADRLKEMNEFWVQATLSTVKEFFKLSKTK* |
Ga0114980_102105071 | 3300009152 | Freshwater Lake | MFDFTKQTKQFEQLAERIKEVNEFWVNAFISSIKQ |
Ga0114980_103195902 | 3300009152 | Freshwater Lake | MFDFTKQTKQFEELAERIKEINEFWINAFVSSIKQFTK* |
Ga0114968_100070677 | 3300009155 | Freshwater Lake | MFNTEFEKQYKEATKQFEELAERVKDVNEFWVNIVLSSAKDFFKVVKTK* |
Ga0114981_101230653 | 3300009160 | Freshwater Lake | MFDFTKQTKQFEQLAERIKEVNEFWVNAFISSIKQFTK* |
Ga0114975_103860802 | 3300009164 | Freshwater Lake | MFDFTKQTKQFEELAARIKEVNDFWVNAIMTTWKDLYESKKK* |
Ga0073936_101186295 | 3300009175 | Freshwater Lake Hypolimnion | MFDFEKPFKQYEELVERVKEVNEFWVNSVFSSVKEFFKIK* |
Ga0114976_100194794 | 3300009184 | Freshwater Lake | MFDFTKQTKQYEELAQRIKEVNEFWYNYMFSSIKDLFNTRKAN* |
Ga0114951_105257732 | 3300009502 | Freshwater | MFDFEKPYKQYEELVERIKDVNEFWINSVFSSFKEFFKIK* |
Ga0114960_100117291 | 3300010158 | Freshwater Lake | MFDFTKQTKQFEQLAERIKEVNEFWVNAVISTWKDLYEARKK* |
Ga0114960_100321426 | 3300010158 | Freshwater Lake | MFDFTQQTKQFEELAERIKEVNEFWFNSVLSSLKQLTKTK* |
Ga0136644_106242711 | 3300010334 | Freshwater Lake | MFDFVKVTKQYEELAERLKEVNEFWINSVISGLKQFTKTK* |
Ga0133913_1000085231 | 3300010885 | Freshwater Lake | MFDFTKQTKQYEELAKRIQEVNEFWINSVISSLKQLTK* |
Ga0133913_103614913 | 3300010885 | Freshwater Lake | MFDFTKQTKQFEQLAERIKETQEFWMNVVMSTWKDLFKVK* |
Ga0133913_105652294 | 3300010885 | Freshwater Lake | LKEKHMFDFTKQTKQFEELAQRIKDVNDFWIDAFISSIKQFTK* |
Ga0133913_107547481 | 3300010885 | Freshwater Lake | PKGKTMFDFTKTTKQFEELSKRIQEVNEFWYTIVKDLFNTAKTK* |
Ga0133913_107616993 | 3300010885 | Freshwater Lake | MFDFTKQTKQFEELAERIKEVNEFWINLVTSTFEDLYKSKKSK* |
Ga0133913_112688151 | 3300010885 | Freshwater Lake | MFDFTKQTKQFEELAQRIKEVNDFWVDAFISSIKQFTKTK* |
Ga0133913_126855844 | 3300010885 | Freshwater Lake | MFDFTKQTKQYEELAQRIKEVNEFWVNSVISSIKELYKSK* |
Ga0133913_132156321 | 3300010885 | Freshwater Lake | MFDFTKQTKQFEELANRIKEVNEFWFKAITETFEDLYKSKKTK* |
Ga0157141_100054114 | 3300012346 | Freshwater | MFDFTKVTKQYEELADRIKEVNEFWINSVLSATKEFFKTAKTK* |
Ga0164296_100278218 | 3300013093 | Freshwater | MFDFEKPYKQYEELIERVRQVNEFWLNSVFYSIKEFFKIK* |
Ga0136642_10148042 | 3300013285 | Freshwater | MFDFTKQTKQYEELAQRIKEVNEFWFKTVTESLEDLFKPKKK* |
Ga0136642_10311553 | 3300013285 | Freshwater | MFDFEKQYKQYEELAQRLKEVNEFWIQSSLSVLKELFKAAKIK* |
Ga0136641_10761442 | 3300013286 | Freshwater | MFDFVKVTKQYEELAERIKEVNEFWINSMVSSAKEFFKVK* |
Ga0134314_1100252 | 3300014711 | Surface Water | MIYSNFEKQYNEAVKQFEELSDRIKQVNEFWINSVLASTKEFFATKKAK* |
Ga0119960_10002202 | 3300014811 | Aquatic | MFDFTKQTKQFEELGERIKEVNEFWINLIFTSAKELFKVK* |
Ga0134315_10198762 | 3300014962 | Surface Water | MYTQFEKAQKQFEELVERVKEVNEFWINSVLSSLKAFYSTSKK* |
Ga0181338_10134892 | 3300015050 | Freshwater Lake | MNYFDFTKQTKQFEQLAERIKEVNEFWINAFVSSIKQFTK* |
Ga0181347_100100510 | 3300017722 | Freshwater Lake | MNYFDFTKQTKQFEQLAERIKEVNEFWINVFVSSIKQFTK |
Ga0181344_10074334 | 3300017754 | Freshwater Lake | MFDFTKQTKQYEELAKRIQEVNEFWVNSVISSLKQFIK |
Ga0181344_10281832 | 3300017754 | Freshwater Lake | MFDFTKQTKQFEELAERIKEVNEFWINSVLSASKEFFKSAKTK |
Ga0181344_10377374 | 3300017754 | Freshwater Lake | MFDFTKQTKQFEELAERIKEVNEFWINSVLSATKEFFKTAKTK |
Ga0181344_10528461 | 3300017754 | Freshwater Lake | MFDFTKVTKLYEELADRLKEVNEFWINSVLSATKEFFKTAKTK |
Ga0181344_10713291 | 3300017754 | Freshwater Lake | HKNLKENTMFDFTKQTKQFEELAERIKEVNEFWINHVFASVKEFYKVK |
Ga0181344_11304112 | 3300017754 | Freshwater Lake | MFEFEKQYKQFEELANRVKEVNEFWVQSTLSTIKEFFKVTKTK |
Ga0181343_10549021 | 3300017766 | Freshwater Lake | MFEFEKQYKQFEELANRVKEVNEFWVQSTLSTIKEFFKVAKAK |
Ga0181343_11187312 | 3300017766 | Freshwater Lake | MIQIEKYTKQFEELAERIKQVNEFWVNAVISSVKEFYKVK |
Ga0211732_12490331 | 3300020141 | Freshwater | MFDFTKQTKQFEELAKRIQEVNEFWINAVLTSTKELFKTK |
Ga0194049_10572142 | 3300020157 | Anoxic Zone Freshwater | MFDFTKQTKQFEELAERIKEVNEFWVNLVMSSFEDFTKPKKK |
Ga0194037_100189318 | 3300020164 | Anoxic Zone Freshwater | MFDFTKQIKQYEELAERIKEVNEFWFNSVISSFKQLTKTK |
Ga0211731_1043458411 | 3300020205 | Freshwater | MFDFTKQTKQYEELAQRLKEVNEFWINAVITSLKQFTK |
Ga0211731_109278102 | 3300020205 | Freshwater | MFDFTKQTKQYEDLAQRIKEVNEFWVNAVISSLKQFTK |
Ga0214194_10028311 | 3300020686 | Freshwater | MIQVEKYFKQYEELVERIKDVNEFWLNSVLSATKEFFKTQKTK |
Ga0214239_10032218 | 3300020688 | Freshwater | MFDFEKPFKQYEELVERVKEVNEFWLQSTLSTIKEFFKIVKTK |
Ga0194047_103581311 | 3300021354 | Anoxic Zone Freshwater | PKMFDFEKQYKDATKQFEELANRVKEVNEFWITSVLSTAKEFFKSVKTK |
Ga0194048_103755651 | 3300021519 | Anoxic Zone Freshwater | MFDFTKQTKQFEELANRIKEVNEFWFKAITETFEDLYKSKKTK |
Ga0222713_107320002 | 3300021962 | Estuarine Water | YEKAYKQYEELAERIKEVNEFWINSILASTKEFFKAAKSK |
Ga0222712_102631003 | 3300021963 | Estuarine Water | MFTQYEKAYKQYEELAERIKEVNEFWINSILASTKEFFKAAKSK |
Ga0181354_10740803 | 3300022190 | Freshwater Lake | MNYFDFTKQTKQFEQLAERIKEVNEFWINAFVSSIKQFTK |
Ga0212088_101339318 | 3300022555 | Freshwater Lake Hypolimnion | MFDFEKPFKQYEELVERVKEVNEFWVNSVFSSVKEFFKIK |
Ga0236342_10948021 | 3300022592 | Freshwater | MFDFTKTTKQFEELAERIKEVNEFWINSVLSSTKEFFKTPKTK |
Ga0256681_123676432 | 3300023311 | Freshwater | MFDFTKQIAQYEELAERIKEVNEFWINSVVSSVKEFYKATKTK |
Ga0209697_101090141 | 3300025316 | Freshwater Lake Hypolimnion | MFDFEKPFKQYEELVERVKEVNEFWVNSVFSSVREFFKIK |
Ga0207957_10073913 | 3300025372 | Freshwater | MFDFEKPYKQYEELVERVRQVNEFWLNSVFYSIKEFFKIK |
Ga0208250_100070024 | 3300025383 | Freshwater | MFEFDKAYKQYEELVERVKEVNEFWINSVFSSVKEFFKVK |
Ga0208250_10477492 | 3300025383 | Freshwater | MYTQFEKAVKHYEELVERLKDVNEFWINSVLSSTKEFFNTIKTK |
Ga0207954_10745432 | 3300025606 | Freshwater | MIDFGYEKAYKQYEELVERLKEVNDFWINSVLSTTKEFFKSIKTK |
Ga0208388_10336243 | 3300025778 | Freshwater | MFDFEKPYKQYEELVERVRQVNEFWLNSVFYSVKEFFNIVKTK |
Ga0208916_100760123 | 3300025896 | Aqueous | MKGNTMFDFTKQTKQYEELAKRIQEVNEFWVNAVISSLKQFIK |
Ga0209188_10361733 | 3300027708 | Freshwater Lake | MFDFTKQTKQYEELAQRIKEVNEFWINSIFSSAKEFFKVK |
Ga0209188_12854292 | 3300027708 | Freshwater Lake | MFDFTQQTKQFEELAERIKEVNEFWFNSVLSSLKQLTKTK |
Ga0209087_10403524 | 3300027734 | Freshwater Lake | MFDFTKQTKQYEELAQRIKEVNEFWYNYMFSSIKDLFNTRKAN |
Ga0209596_11590212 | 3300027754 | Freshwater Lake | MFNTEFEKQYKEATKQFEELAERVKDVNEFWVNIVLSSAKDFFKVVKTK |
Ga0209598_1000102132 | 3300027760 | Freshwater Lake | MFDFTKQTKQFEQLAERIKEVNDFWIDAFISSIKQFTK |
Ga0209088_1000219311 | 3300027763 | Freshwater Lake | MFEFEKQFKQYEELADRLKEMNEFWVQATLSTVKEFFKLSKTK |
Ga0209829_100764913 | 3300027777 | Freshwater Lake | LKEKHMFDFTKQTKQFEELAQRIKDVNDFWIDAFISSIKQFTK |
Ga0209829_102311701 | 3300027777 | Freshwater Lake | MFDFTKQTKQFEQLAERIKEVNEFWVNAVISTWKDLYEARKK |
Ga0209777_111874032 | 3300027896 | Freshwater Lake Sediment | MYNFDKAYKQYEDFVEQVKQINEFWVNSVFSSFKEFFKIK |
Ga0209191_12455071 | 3300027969 | Freshwater Lake | MFDFTKQTKQFEELAARIKEVNDFWVNAIMTTWKDLYESKKK |
Ga0209401_10244212 | 3300027971 | Freshwater Lake | MFDFTKQTKQFEQLAERIKEVNEFWINAFVSSIKQFTK |
Ga0209298_101152163 | 3300027973 | Freshwater Lake | MFDFTKQTKQFEELAERIKEINEFWINAFVSSIKQFTK |
Ga0209299_10729723 | 3300027974 | Freshwater Lake | MFDFTKQTKQFEQLAERIKEVNEFWVNAFISSIKQFTK |
Ga0316219_100055159 | 3300031759 | Freshwater | MFDFEKPYKQYEELIERVRQVNEFWLNSVFYSIKEFFKIK |
Ga0315274_101779743 | 3300031999 | Sediment | MFDFTKQTKQYEELAQRIKEVNEFWIDAIVTSLKQFTK |
Ga0334991_0000191_58851_58982 | 3300034013 | Freshwater | MFDFTKQTKQFEELAKRIQEVNEFWINSVLTSTKEFFNTAKTK |
Ga0334983_0137917_183_314 | 3300034060 | Freshwater | MFDFTKQTKQFEELAARIKEVNEFWINSVLTSTKEFFNTAKTK |
⦗Top⦘ |