NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F102418

Metagenome / Metatranscriptome Family F102418

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102418
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 69 residues
Representative Sequence MSTDKTIRRVTDLKAQRLETYRYWRSRPCAERMDAVAEIVRDAYLAKGIDLDHRPSDKTLVRVERPNWKAI
Number of Associated Samples 81
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 73.27 %
% of genes near scaffold ends (potentially truncated) 23.76 %
% of genes from short scaffolds (< 2000 bps) 78.22 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.099 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(19.802 % of family members)
Environment Ontology (ENVO) Unclassified
(48.515 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(38.614 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.35%    β-sheet: 0.00%    Coil/Unstructured: 64.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF03989DNA_gyraseA_C 16.83
PF09970DUF2204 15.84
PF01850PIN 8.91
PF05973Gp49 2.97
PF13193AMP-binding_C 1.98
PF01844HNH 1.98
PF02863Arg_repressor_C 0.99
PF01555N6_N4_Mtase 0.99
PF00583Acetyltransf_1 0.99
PF02962CHMI 0.99
PF01546Peptidase_M20 0.99
PF04244DPRP 0.99
PF02368Big_2 0.99
PF09932DUF2164 0.99
PF02517Rce1-like 0.99
PF03030H_PPase 0.99
PF09723Zn-ribbon_8 0.99
PF00698Acyl_transf_1 0.99
PF02810SEC-C 0.99
PF13676TIR_2 0.99
PF07690MFS_1 0.99
PF13443HTH_26 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG0188DNA gyrase/topoisomerase IV, subunit AReplication, recombination and repair [L] 16.83
COG3657Putative component of the toxin-antitoxin plasmid stabilization moduleDefense mechanisms [V] 2.97
COG4679Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin systemDefense mechanisms [V] 2.97
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.99
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.99
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.99
COG1438Arginine repressorTranscription [K] 0.99
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.99
COG3046Uncharacterized conserved protein related to deoxyribodipyrimidine photolyaseGeneral function prediction only [R] 0.99
COG32325-carboxymethyl-2-hydroxymuconate isomeraseAmino acid transport and metabolism [E] 0.99
COG3808Na+ or H+-translocating membrane pyrophosphataseEnergy production and conversion [C] 0.99
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.10 %
UnclassifiedrootN/A9.90 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003323|rootH1_10371106All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1856Open in IMG/M
3300004080|Ga0062385_10430666All Organisms → cellular organisms → Bacteria → Acidobacteria796Open in IMG/M
3300004092|Ga0062389_100057575All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00683158Open in IMG/M
3300004092|Ga0062389_102501511All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium685Open in IMG/M
3300006120|Ga0007867_1033798All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1139Open in IMG/M
3300009101|Ga0105247_11478035Not Available553Open in IMG/M
3300009177|Ga0105248_10280199Not Available1877Open in IMG/M
3300009500|Ga0116229_10462788All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1053Open in IMG/M
3300009518|Ga0116128_1003869All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5889Open in IMG/M
3300009548|Ga0116107_1184107All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300009630|Ga0116114_1162359All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300009641|Ga0116120_1109249All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii908Open in IMG/M
3300009644|Ga0116121_1067513All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1118Open in IMG/M
3300009709|Ga0116227_10357923All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1114Open in IMG/M
3300014155|Ga0181524_10104129All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1576Open in IMG/M
3300014158|Ga0181521_10262484All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii905Open in IMG/M
3300014160|Ga0181517_10500659Not Available615Open in IMG/M
3300014161|Ga0181529_10365797All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300014161|Ga0181529_10429712All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii709Open in IMG/M
3300014167|Ga0181528_10625915All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii598Open in IMG/M
3300014169|Ga0181531_10000796All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae20673Open in IMG/M
3300014199|Ga0181535_10539711All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300014491|Ga0182014_10003108All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae20297Open in IMG/M
3300014491|Ga0182014_10023716All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5045Open in IMG/M
3300014491|Ga0182014_10225747All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300014492|Ga0182013_10081531All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2266Open in IMG/M
3300014492|Ga0182013_10162270All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus1393Open in IMG/M
3300014492|Ga0182013_10175787All Organisms → cellular organisms → Bacteria1317Open in IMG/M
3300014495|Ga0182015_10770448All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii605Open in IMG/M
3300014499|Ga0182012_10373271All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae946Open in IMG/M
3300014654|Ga0181525_10000002All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae286887Open in IMG/M
3300014655|Ga0181516_10000023All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae157509Open in IMG/M
3300014657|Ga0181522_10399109All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae822Open in IMG/M
3300014658|Ga0181519_10899071All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300014838|Ga0182030_10459572All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1292Open in IMG/M
3300014839|Ga0182027_10178007All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2483Open in IMG/M
3300017931|Ga0187877_1014795All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis4518Open in IMG/M
3300017931|Ga0187877_1211161All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii758Open in IMG/M
3300017935|Ga0187848_10403640Not Available563Open in IMG/M
3300017948|Ga0187847_10000128All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae87921Open in IMG/M
3300017948|Ga0187847_10093067All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1667Open in IMG/M
3300017948|Ga0187847_10878278All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus510Open in IMG/M
3300017988|Ga0181520_10001143All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae55521Open in IMG/M
3300017988|Ga0181520_10190950All Organisms → cellular organisms → Bacteria1619Open in IMG/M
3300017988|Ga0181520_10200044All Organisms → cellular organisms → Bacteria → Acidobacteria1570Open in IMG/M
3300017988|Ga0181520_10287049All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1238Open in IMG/M
3300018013|Ga0187873_1088652All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1242Open in IMG/M
3300018030|Ga0187869_10145136All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1179Open in IMG/M
3300018030|Ga0187869_10163451Not Available1100Open in IMG/M
3300018034|Ga0187863_10443015All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii725Open in IMG/M
3300018038|Ga0187855_10271754All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300018043|Ga0187887_10507512All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii711Open in IMG/M
3300018046|Ga0187851_10299367All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii933Open in IMG/M
3300018047|Ga0187859_10516163All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii666Open in IMG/M
3300019240|Ga0181510_1413069All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1656Open in IMG/M
3300019258|Ga0181504_1273894All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5546Open in IMG/M
3300019787|Ga0182031_1209026All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1760Open in IMG/M
3300019787|Ga0182031_1419062All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli1374Open in IMG/M
3300021170|Ga0210400_11494165All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300021433|Ga0210391_10811865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae731Open in IMG/M
3300023088|Ga0224555_1043870All Organisms → cellular organisms → Bacteria → Proteobacteria1710Open in IMG/M
3300023258|Ga0224535_1040092All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1092Open in IMG/M
3300025498|Ga0208819_1106049All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii590Open in IMG/M
3300027860|Ga0209611_10321195All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae905Open in IMG/M
3300028087|Ga0255354_1043561All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli996Open in IMG/M
3300028552|Ga0302149_1022592All Organisms → cellular organisms → Bacteria → Acidobacteria1651Open in IMG/M
3300028560|Ga0302144_10130584All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300028574|Ga0302153_10198424Not Available687Open in IMG/M
3300028745|Ga0302267_10172583All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii982Open in IMG/M
3300028748|Ga0302156_10146536All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa1151Open in IMG/M
3300028762|Ga0302202_10037971All Organisms → cellular organisms → Bacteria3302Open in IMG/M
3300028866|Ga0302278_10092909All Organisms → cellular organisms → Bacteria1700Open in IMG/M
3300028873|Ga0302197_10278647All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii759Open in IMG/M
3300029907|Ga0311329_10303248All Organisms → cellular organisms → Bacteria1159Open in IMG/M
3300029911|Ga0311361_10668804All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii963Open in IMG/M
3300029911|Ga0311361_11234584Not Available594Open in IMG/M
3300029915|Ga0311358_10606859All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae825Open in IMG/M
3300029920|Ga0302142_1076591All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1041Open in IMG/M
3300029955|Ga0311342_10017712All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00689430Open in IMG/M
3300029984|Ga0311332_10069601All Organisms → cellular organisms → Bacteria2502Open in IMG/M
3300029986|Ga0302188_10405488All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylocaldum → unclassified Methylocaldum → Methylocaldum sp. 14B557Open in IMG/M
3300029990|Ga0311336_10474352All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300030519|Ga0302193_10017935All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5091Open in IMG/M
3300030688|Ga0311345_10626303All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae885Open in IMG/M
3300031090|Ga0265760_10220406Not Available647Open in IMG/M
3300031524|Ga0302320_10009878All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae20444Open in IMG/M
3300031524|Ga0302320_10292108All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2177Open in IMG/M
3300031524|Ga0302320_11120729All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii817Open in IMG/M
3300031670|Ga0307374_10072065All Organisms → cellular organisms → Bacteria3272Open in IMG/M
3300031672|Ga0307373_10318635All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii971Open in IMG/M
3300031708|Ga0310686_103710865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii645Open in IMG/M
3300031708|Ga0310686_110069565All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1289Open in IMG/M
3300031918|Ga0311367_10449764All Organisms → cellular organisms → Bacteria1325Open in IMG/M
3300033402|Ga0326728_10104718All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3382Open in IMG/M
3300033402|Ga0326728_10253909All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1670Open in IMG/M
3300033402|Ga0326728_10458890Not Available1056Open in IMG/M
3300033405|Ga0326727_10007946All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae27443Open in IMG/M
3300033818|Ga0334804_044540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1323Open in IMG/M
3300033822|Ga0334828_046058All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1218Open in IMG/M
3300033983|Ga0371488_0176419All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1096Open in IMG/M
3300034282|Ga0370492_0457808Not Available517Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog19.80%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland15.84%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog15.84%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog9.90%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.94%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil4.95%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil4.95%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.97%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.97%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.99%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.99%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.99%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.99%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003323Sugarcane root Sample H1Host-AssociatedOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300006120Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08EnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009500Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009709Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300019240Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019258Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300023258Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34EnvironmentalOpen in IMG/M
3300025498Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027860Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes)Host-AssociatedOpen in IMG/M
3300028087Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T50EnvironmentalOpen in IMG/M
3300028552Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300028873Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029920Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3EnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030519Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031672Soil microbial communities from Risofladan, Vaasa, Finland - OX-2EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300033822Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9EnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
rootH1_1037110613300003323Sugarcane Root And Bulk SoilKVIRRVHDLNAQRQETYSYWRDRSVAERMQAVAEIVRDAYAMKGINLDAMPVTRTLVRARIAGGKGTDDVR*
Ga0062385_1043066623300004080Bog Forest SoilMTFVEEKTIRRVSDFKSQREETYRYWLSRPVSERMEAIDEIVRSAYLAKGIDIDALASDRTIVRVVRAGWKA*
Ga0062389_10005757533300004092Bog Forest SoilMTFVEEKTIRRVSDFKSQREETYRYWLSRPIAERMEAIDEIVRSAYLAKGIDIDALASDRTIVRVVRAGWKA*
Ga0062389_10250151123300004092Bog Forest SoilMDKTIRRVTDLKEQRMETYRYWRSRSAAERMEAVAEIVRDAYLTKGIDLDSIPPDKTLIRVERLSWKAK*
Ga0007867_103379833300006120FreshwaterMAMDKTIRRVTDLKAQRLETYRYWRTRTCAERMQAVAELVRDAYLAKGIDLDLRPSNKTLARVQRPNWKAI*
Ga0105247_1147803513300009101Switchgrass RhizosphereGIMSTDRIVRRVTDFKAQREETYHYWRSRTIAERIEAVAELVRDAYFAKGVEVEKRAPDKTIVRVERPGWKAVR*
Ga0105248_1028019913300009177Switchgrass RhizosphereMSTDRIVRRVTDFKAQREETYHYWRSRTIAERIEAVAELVRDAYFAKGVDVEKRAPDKTIVRVERPGWKAVR*
Ga0116229_1046278823300009500Host-AssociatedMDKTLRRVTDLKEQHMDTYRYRRSRTVGERMEAVYEITRAVSLTRGIDIDSLPSDKTIVRAERASWKAK*
Ga0116128_100386923300009518PeatlandMSTDKTIRRVTDLKAQRLETYRYWQSRSCAERMEAVVEIVRGAYLAKGIDIDHRPSDRTLVRVERPNWKAI*
Ga0116107_118410723300009548PeatlandMSTDRTIRRVTDLKAQRLEAYRYWRNRTCAERMEAVAEIVRDAYLAKGIDLDHRPSDRTLVRVERPNWKAI*
Ga0116114_116235913300009630PeatlandMSTDKTIRRVMDLKAQRLETYHYWRSRTCAERMEAVAEIVRSAYLSKGINLDQQPADKTLVRVERPNWKAI*
Ga0116120_110924913300009641PeatlandMGTDKTIRRVTNPKAQRLETYRYWRSRTCAERMEAIAEIVRDAYRAKGIDLDLRPSDKSLVRVERPNWKAI*
Ga0116121_106751323300009644PeatlandMSTDKTIRRVTDLKEQRLETYRYWRSRTCAERMAAVDEIVRSAYLSKGIDLDQLPSDKTLRRVERPNWKAA*
Ga0116227_1035792323300009709Host-AssociatedMDKSIRRVTDLKEQRMETYRYWRSRTVGERMEAVYEITRDVSLTRGIDIDSLPSDKTIVRAERASWKAK*
Ga0181524_1010412923300014155BogMDKTLRRVTDLKEQRLETYHYWQSRSCAERMDAVAEIIRGAYLAKGIDLDHRPSDKTLVRVERPNWKAI*
Ga0181521_1026248433300014158BogGTDKTIRRVTNPKAQRLETYRYWRSRTCAERMEAIAEIVRDAYRAKGIDLDLRPSDKSLVRVERPNWKAI*
Ga0181517_1050065923300014160BogMDKSIRKVTDLEEQQAETYRYWASRTVAEKFAAIDEIVRQAYRFKGIRVDEMPSSRTLVRVERPDWKAL*
Ga0181529_1036579723300014161BogMSIDKTIRRVTDFKAQRLETYRYWRSRPCAERMDAVTEIVRSAYLSKGIDLDQLPSDKTLKRIERPDWKAA*
Ga0181529_1042971223300014161BogMDKTIRRVTDLNAQRLETYRYWRGRTCAERMEAVAEIVRDAYLAKGIDLDHRPADKTIIRVERPHWKAI*
Ga0181528_1062591523300014167BogMSTDKTIRRVTDLKAQRLETYRYWRSRPCAERMDAVAEIVRDAYLAKGIDLDHRPSDKTLVRVERPNWKAI*
Ga0181531_1000079663300014169BogMEKAIRRVADFKVQRLETYRYWRSRSCAERMEAVAEIVRDAYLAKGIDLGVRPSNKTLVRVERPNWKAI*
Ga0181535_1053971123300014199BogLNIDKTIRRVTDFKAQRLETYRYWRSRSCAERMEAVAEIVRGAYLAKGIDIDRRPPDKRLVRVERPNWRA*
Ga0182014_10003108163300014491BogMSADKTIRRVTDFKAQRQETYRYWRSRSCAERMAAVAKIVRDAYLAKGIDVDRMPSDKTLVRVERPNWKAI*
Ga0182014_1002371633300014491BogMRINRTIRRVTDLKAQRLETYRYWQSRPCAERIEAVAEIVRGAYLAKGIDLELRPSDKTLVRVERPTWKAV*
Ga0182014_1022574723300014491BogMSTDKTIRRVTDPKAQRMETYRYWRSRPCAERMEAVAEIVRCAYLSKGIDLEDRPTNKTLVRVERPNWKAL*
Ga0182013_1008153133300014492BogMTIDKTIRRVTDFKAQRMETYRYWRSRPCAERMEAVAEIVRCAYLSKGIDLEDRPTNKTLVRVERPNWKAL*
Ga0182013_1016227023300014492BogMDKTLRRVTDIKAQRLETYRYWQSRSCAERLEAVAEIVRWAYLAKGIDLDHRPSDRTLVRVERPNWKAI*
Ga0182013_1017578713300014492BogMSIDKTIRRVTDFKAQRMETYRYWRSRTCAERMAAVEEIVRSAYLSKGIDLDQLPSDKTLKRVERPNWKAA*
Ga0182015_1077044813300014495PalsaRRVTDFKAQRMETYRYWRSRPCAERMEAVAEIVRCAYLSKGIDLEDRPTNKTLVRVERPNWKAL*
Ga0182012_1037327113300014499BogKTIRRVTDFKAQRMETYRYWRSRPCAERMEAVAEIVRCAYLSKGIDLEDRPTNKTLVRVERPNWKAL*
Ga0181525_100000021223300014654BogMSTKIKDATMPVDKTIRRVTDLTAQRLETYRYWRSRTGAERMEAVAEIVRDAYLAKGIDLELRPLDKTLVRVERPAWKAI*
Ga0181516_1000002333300014655BogMPVDKTIRRVTDLTAQRLETYRYWRSRTGAERMEAVAEIVRDAYLAKGIDLELRPLDKTLVRVERPAWKAI*
Ga0181522_1039910923300014657BogMMSDNKTILRVTDLAAQRLETYRYWRSRTAAERMEAVAEIVRSAYLSKGIDLDKRPADKTLVRVERPNWKAI*
Ga0181519_1089907123300014658BogMDKTIRRVTDFKAQRLESYLYWRSRTCAERMAAVEEIVRSAYLSKGIDLDRLPSDRTLKRVERPNWKAA*
Ga0182030_1045957223300014838BogRVTDLKAQREETYRYWRSRPCVERMEAIAEIVRDAYFAKGIDIEHRPSDKTLIRAVRPNWKAI*
Ga0182027_1017800733300014839FenMNTDKTIRRVTDLKAQRLETYRYWRSRTCAERMAAVEEIVRSAYLSKGIDLDQLPSDKTLKRVERPDWKAA*
Ga0187877_101479523300017931PeatlandMSTDKTIRRVTDLKAQRLETYRYWQSRSCAERMEAVVEIVRGAYLAKGIDIDHRPSDRTLVRVERPNWKAI
Ga0187877_121116113300017931PeatlandMSTDRTIRRVTDLKAQRLEAYRYWRNRTCAERMEAVAEIVRDAYLAKGIDLDHRPSDRTLVRVERPNWKAI
Ga0187848_1040364013300017935PeatlandMDKTIRKVTDLKAQQAETYRYWQSRTCAEHMAAVEEIVRSAYLAKGIDLDHQPSDRTLVR
Ga0187847_10000128333300017948PeatlandMGTMSIDKTIRRVTDLKAQRLETYRYWRSRPCAERMAAVEEIVRSAYLSKGIDLDQLPSDKTLKRVERPNWKAL
Ga0187847_1009306733300017948PeatlandMRTMSTDKTIRRVTDLKEQRLETYRYWRSRTCAERMAAVDEIVRSAYLSKGIDLDQLPSDKTLRRVERPNWKAA
Ga0187847_1087827823300017948PeatlandSIDKTIRRVTDLKAQRLETYRYWRSRTCAERTAAVEEIVRDAYLAKGIDLELRPSDKTLVRVERPNWKAI
Ga0181520_1000114363300017988BogMDKTIRRVTDFKAQRLETYLYWRSRTCAERMAAVEEIVRSAYLSKGIDLDRLPSDRTLKRVERPNWKAA
Ga0181520_1019095023300017988BogLNIDKTIRRVTDFKAQRLETYRYWRSRSCAERMEAVAEIVRGAYLAKGIDIDRRPPDKRLVRVERPNWRA
Ga0181520_1020004433300017988BogMSIDKTIRRVTDFKAQRLETYRYWRSRPCAERMDAVTEIVRSAYLSKGIDLDQLPSDKTLKRIERPDWKAA
Ga0181520_1028704913300017988BogNPKAQRLETYRYWRSRTCAERMEAIAEIVRDAYRAKGIDLDLRPSDKSLVRVERPNWKAI
Ga0187873_108865213300018013PeatlandSTDKTIRRVTDLKAQRLETYRYWQSRSCAERMEDVVEIVRGAYLAKGIDIDHRPSDRTLVRVERPNWKAI
Ga0187869_1014513643300018030PeatlandKAQRLETYRYWQSRSCAERMEAVVEIVRGAYLAKGIDIDHRPSDRTLVRVERPNWKAI
Ga0187869_1016345123300018030PeatlandMSTDKTIRRVTDLKVQREETYSYWRSRTCAERMAAVEEIVRSAYLAKGIDLDHRPSDRTLVRVDRPNWKAI
Ga0187863_1044301523300018034PeatlandMSMDKTLRRVTDFKAQRLETYRYWRSRTCAERTAAVEEIVRDAYLAKGIDLELRPSDKTLVRVERPNWKAI
Ga0187855_1027175423300018038PeatlandMSIDKTIRRVTDLKAQRLETYRYWRSRTCAERTAAVEEIVRDAYLAKGIDLELRPSDKTLVRVERPNWKAI
Ga0187887_1050751223300018043PeatlandMSMDKTLRRVTDFKAQRLETYRYWRSRSCAERMEAIAEIVRDAYRAKGIDLDLRPSDKSLVRVERPNWKAI
Ga0187851_1029936733300018046PeatlandMSMDKTLRRVTDFKAQRLETYRYWRSRPCAERMEAVAEIVRSAYLAKGIDLEHRPPNKMLVRVERPDWKA
Ga0187859_1051616313300018047PeatlandVQVSFLRPGISNREKWMRTMSTDKTIRRVTDLKEQRLETYRYWRSRTCAERMAAVDEIVRSAYLSKGIDLDQLPSDKTLRRVERPNWKAA
Ga0181510_141306923300019240PeatlandMEKAIRRVADFKVQRLETYRYWRSRSCAERMEAVAEIVRDAYLAKGIDLGVRPSNKTLVRVERPNWKAI
Ga0181504_127389453300019258PeatlandMPVDKTIRRVTDLTAQRLETYRYWRSRTGAERMEAVAEIVRDAYLAKGIDLELRPLDKTLVRVERPAWKAI
Ga0182031_120902653300019787BogMTIDKTIRRVTDFKAQRMETYRYWRSRPCAERMEAVAEIVRCAYLSKGIDLEDRPTNKTLVRVERPNWKAL
Ga0182031_141906223300019787BogMSADKTIRRVTDFKAQRQETYRYWRSRSCAERMAAVAKIVRDAYLAKGIDVDRMPSDKTLVRVERPNWKAI
Ga0210400_1149416513300021170SoilMSTVKIIRKVTDLKAQREETYRYWQGRTYAERLEAVAEIVRGAYLTKGIDLEMRPTDKTLVRAIRPTWKAV
Ga0210391_1081186523300021433SoilMDKTIRRVTDLKEQRMETYRYWRSRSAAERMEAVAEIVRDAYLTKGIDLDSRPPDKTLIRVERLSWKAK
Ga0224555_104387013300023088SoilMSIDKTIRRVTDFKAQRMETYRYWRSRPCAERMAAVEEIVRSAYLSKGIDLDQLPSDKTLVRVERPNWKAL
Ga0224535_104009233300023258SoilMDKTLRRVTDIKAQRLETYRYWQSRSCAERLEAVAEIVRGAYLAKGIDLDHRPSDRTLVRVERPNWKAI
Ga0208819_110604913300025498PeatlandMGTDKTIRRVTNPKAQRLETYRYWRSRTCAERMEAIAEIVRDAYRAKGIDLDLRPSDKSLVRVERPNWKAI
Ga0209611_1032119523300027860Host-AssociatedMDKTLRRVTDLKEQHMETYRYWRSRTVGERMEAVYEITRDVSLTRGIDIDSLPSDKTIVRAERASWKAK
Ga0255354_104356113300028087SoilMSADKTIRRVTDFKAQRQETYRYWRSRSCAERMAAVAKIVRDAYLAKGIDVDRMPSDKTLVR
Ga0302149_102259243300028552BogMTIDKTIRRVTDFKAQRMETYRYWRSRSCAERMEAVAEIVRCAYLSKGIDLEDRPTNKTLVRVERPNWKAL
Ga0302144_1013058423300028560BogVSGNEAMRVDKVIRPVVDFKEQRLETYRYWQNRPCAERMEAVAEIVRDAYFAKGIHLNGRSSDK
Ga0302153_1019842423300028574BogMRINRTIRRVTDLKAQRLETYRYWQSRPCAERIEAVAEIVRGAYLAKGIDLELRPSDKT
Ga0302267_1017258323300028745BogMEVRKMPTDKTIRRITDLKAQREETYSYWRSRPISERMEAVAEIVRTVYLFKGIDLDARPTDKTIVRVERPGWKAS
Ga0302156_1014653613300028748BogMPTDKTIRRITDLKAQREETYSYWRSRPISERMEAVAEIVRTVYLFKGIDLDARPTDK
Ga0302202_1003797153300028762BogMTIDKTIRRVTDFKAQRMETYRYWRSRSCAERMEAVAEIVRCAYLSKGIDLEDRPTNKTLIRVERPNWKAL
Ga0302278_1009290933300028866BogMTIDKTIRRVTDFKAQRMEAVAEIVRCAYLSKGIDLEDRPTNKTLVRVERPNWKAL
Ga0302197_1027864713300028873BogITDLKAQREETYSYWRSRPISERMEAVAEIVRTVYLFKGIDLDARPTDKTIVRVERPGWKAS
Ga0311329_1030324823300029907BogMPTDKTIRRITDLKAQREETYSYWRSRPISERMEAVAEIVRTVYLFKGIDLDARPTDKTIVRVERPGWKAS
Ga0311361_1066880423300029911BogMSTDKTIRRVTDLKAQRLETYRYWRSRPCAERMDAVAEIVRDAYLAKGIDLDHRPSDKTLVRVERPNWKAI
Ga0311361_1123458423300029911BogMDKTIRKVIDLKAQRLETYRYWQGRTSIERMEAVTQIVKDAYFAKGIDLEQRPPNRSLVRIERPSWKAI
Ga0311358_1060685913300029915BogRRVTDLKEQQLETCSYWRSRPCAERMEAVAEIVRGAYLAKGIDVETRPMDKTLVRVERPNWKAI
Ga0302142_107659113300029920BogTIDKTIRRVTDFKAQRMETYRYWRSRSCAERMEAVAEIVRCAYLSKGIDLEDRPTNKTLVRVERPNWKAL
Ga0311342_1001771253300029955BogVSGNEAMRVDKVIRPVVDFKEQRLETYRYWQNRPCAERMEAVVEIVRDAYFAKGIHLNGRSSDK
Ga0311332_1006960133300029984FenMSTDKTIRRVTDLKAQRLETYRYWRTRTCAERMQAVAELVRDAYLAKGIDLDLRPSNKTLARVKRPNWKAIEKPKQNGDVTDA
Ga0302188_1040548823300029986BogMTIDKTIRRVTDFKAQRMETYRYWRSRPCAERMEAVAEIVRCAYLSKGIDLEDRPTNKTLVRVERPNWK
Ga0311336_1047435223300029990FenMSTDKTIRRVTDLKAQRLETYRYWRTRTCAERMQAVAELVRDAYLAKGIDLDLRPSNKTLARVKRPNWKAI
Ga0302193_1001793543300030519BogMSADKTIRRVTDFKAQRQETYRYWRSRSCAERMAAVAKIVRDAYLAKGIDVDRMPSDKTL
Ga0311345_1062630333300030688BogIRRVTDFKAQRMETYRYWRSRPCAERMEAVAEIVRCAYLSKGIDLEDRPTNKTLVRVERPNWKAL
Ga0265760_1022040613300031090SoilMITEKAIRRVTDFKQQRLETYRYWRSRTCAERMEAVAEIVRDAYLAKGIDLELRPTDKTLVRGERPNWKAI
Ga0302320_1000987893300031524BogMSIDKTIRRVTDFKAQRLETYRYWRSRTCAERMEAVAEIVRSAYLAKGINLDRRPSDKTLVRVERPNWKAI
Ga0302320_1029210813300031524BogSGNEAMRVDKVIRPVVDFKEQRLETYRYWQNRPCAERMEAVAEIVRDAYFAKGIHLNGRSSDK
Ga0302320_1112072923300031524BogKMPADKTIRRITDLKAQREETYSYWRSRPISERMEAVAEIVRTVYLFKGIDLDARPTDKTIVRVERPGWKAS
Ga0307374_1007206543300031670SoilMSVDKTIRKVTDFTAQRIETYRYWQSRPAAERMDAVEEMVREAYFAKGIDLDLRPSDKTLVRVERPSWKAA
Ga0307373_1031863533300031672SoilMSGNKTVRKVTDLKEQQLETYRYWQTRTAAERMEAVAEIVRSAYLAKGIDISKRQSDKTLRHVARPDWKAV
Ga0310686_10371086513300031708SoilTIRKVIDPKAQRLETYRYWQSRTSVERMEAVAQIVKDAYFAKGIDLEQRQPNRSLVRIERPSWKAI
Ga0310686_11006956533300031708SoilMDKSIRRVTDLKEQRMETYRYWRTRSAAERMDAVAEIVRDVYLTKGIDLDSRPVDKTLLRIERPLWKAK
Ga0311367_1044976423300031918FenMSTDKTIRRVTDLKAQRLETYRYWRTRTCAERMQAVAELVRDAYLAKGIDLDLRPSNKTLARVKRPDWKAI
Ga0326728_1010471843300033402Peat SoilMGTDKTIRRVTDLKAQRLETYRYWRSRSCAERMEAIAEIVRDAYRAKGIDLDLRPSDKSLVRVERPNWKAI
Ga0326728_1025390923300033402Peat SoilMSTDKTIRRVMDLKAQRLETYHYWRSRTCAERMEAVAEIVRSAYLSKGINLDQQPADKTLVRVERPNWKAI
Ga0326728_1045889013300033402Peat SoilMDKILRRVTDLKAQREETYRYWRSRSCAERMAAVAEIVRDAYLAKGIDLDHRPSDKTLVRVQRPNWKAI
Ga0326727_1000794683300033405Peat SoilMDKILRRVTDLKAQREETYRYWRSRSCAERMAAVAEIVRDAYLAKGIDLDHRPSDRTLVRVERPNWKAI
Ga0334804_044540_347_5623300033818SoilMTIDKTIRRVTDFKAQRMETYRYWRGRPCAERMEAVAEIVRCAYLSKGIDLEDRPTNKTLVRVERPNWKAL
Ga0334828_046058_1020_12083300033822SoilVTDFKAQRMETYRYWRSRPCAERMEAVAEIVRCAYLSKGIDLEDRPTNKTLVRVERPNWKAL
Ga0371488_0176419_370_5763300033983Peat SoilMDKILRRVTDLKAQREETYRYWRSRSCAERMAVAEIVRDAYLAKGIDLDHRPSDRTLVRVERPNWKAI
Ga0370492_0457808_121_3363300034282Untreated Peat SoilMSIDKTIRRVTDLSAQREETYRYWRSRTCAERMAAVEEIVRDAYLSKGIDLDHRPLNKTLIRVERPNWKAI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.