NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101897

Metagenome / Metatranscriptome Family F101897

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101897
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 100 residues
Representative Sequence MIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEAILDGYRALNPNGIYGREEYKAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG
Number of Associated Samples 72
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 71.57 %
% of genes near scaffold ends (potentially truncated) 27.45 %
% of genes from short scaffolds (< 2000 bps) 82.35 %
Associated GOLD sequencing projects 58
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (45.098 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(68.627 % of family members)
Environment Ontology (ENVO) Unclassified
(93.137 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(81.373 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.38%    β-sheet: 24.03%    Coil/Unstructured: 56.59%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF04308RNaseH_like 1.96
PF06941NT5C 0.98
PF13620CarboxypepD_reg 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG45025'(3')-deoxyribonucleotidaseNucleotide transport and metabolism [F] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.20 %
UnclassifiedrootN/A9.80 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001450|JGI24006J15134_10062127All Organisms → Viruses → Predicted Viral1471Open in IMG/M
3300001450|JGI24006J15134_10083580All Organisms → Viruses → Predicted Viral1187Open in IMG/M
3300001450|JGI24006J15134_10103467All Organisms → Viruses → Predicted Viral1017Open in IMG/M
3300001450|JGI24006J15134_10177227All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.672Open in IMG/M
3300002514|JGI25133J35611_10050290All Organisms → Viruses → Predicted Viral1411Open in IMG/M
3300002514|JGI25133J35611_10061174All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1221Open in IMG/M
3300002518|JGI25134J35505_10004035All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.5496Open in IMG/M
3300002519|JGI25130J35507_1061875All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.721Open in IMG/M
3300003514|FS821DNA_1012730All Organisms → Viruses → Predicted Viral1976Open in IMG/M
3300005521|Ga0066862_10150001Not Available783Open in IMG/M
3300006164|Ga0075441_10070520All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1362Open in IMG/M
3300006164|Ga0075441_10104395All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1086Open in IMG/M
3300006736|Ga0098033_1004658All Organisms → Viruses → Predicted Viral4783Open in IMG/M
3300006751|Ga0098040_1251780All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon511Open in IMG/M
3300006754|Ga0098044_1200039All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon786Open in IMG/M
3300006789|Ga0098054_1054150All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1532Open in IMG/M
3300006789|Ga0098054_1078733All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon1244Open in IMG/M
3300006789|Ga0098054_1078780All Organisms → Viruses → Predicted Viral1244Open in IMG/M
3300006789|Ga0098054_1079246All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1239Open in IMG/M
3300006789|Ga0098054_1120573All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.976Open in IMG/M
3300006793|Ga0098055_1027022All Organisms → Viruses → Predicted Viral2400Open in IMG/M
3300006793|Ga0098055_1101453All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1124Open in IMG/M
3300006793|Ga0098055_1322782All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.575Open in IMG/M
3300006924|Ga0098051_1033269All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1456Open in IMG/M
3300006924|Ga0098051_1046074All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1213Open in IMG/M
3300006925|Ga0098050_1030400All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1468Open in IMG/M
3300006925|Ga0098050_1052920All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1067Open in IMG/M
3300006926|Ga0098057_1025505All Organisms → Viruses → Predicted Viral1478Open in IMG/M
3300006990|Ga0098046_1084096All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.715Open in IMG/M
3300007229|Ga0075468_10001595All Organisms → cellular organisms → Bacteria9676Open in IMG/M
3300007276|Ga0070747_1163003All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.797Open in IMG/M
3300007510|Ga0105013_1180536All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1283Open in IMG/M
3300007512|Ga0105016_1040429All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.3562Open in IMG/M
3300007758|Ga0105668_1011815All Organisms → Viruses → Predicted Viral1675Open in IMG/M
3300008050|Ga0098052_1209839All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.754Open in IMG/M
3300008050|Ga0098052_1339855All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon563Open in IMG/M
3300009071|Ga0115566_10223198All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1140Open in IMG/M
3300009173|Ga0114996_10122194All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2177Open in IMG/M
3300009378|Ga0118726_1077498All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1398Open in IMG/M
3300009425|Ga0114997_10153228All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1361Open in IMG/M
3300009705|Ga0115000_10236588All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1195Open in IMG/M
3300009705|Ga0115000_10281352All Organisms → Viruses → Predicted Viral1079Open in IMG/M
3300009785|Ga0115001_10264485All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1098Open in IMG/M
3300009786|Ga0114999_10554156Not Available879Open in IMG/M
3300010149|Ga0098049_1040388All Organisms → Viruses → Predicted Viral1502Open in IMG/M
3300010150|Ga0098056_1120411All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon891Open in IMG/M
3300010150|Ga0098056_1262094All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.572Open in IMG/M
3300010153|Ga0098059_1410280All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon511Open in IMG/M
3300010155|Ga0098047_10083050All Organisms → Viruses → Predicted Viral1252Open in IMG/M
3300010883|Ga0133547_11534198All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1248Open in IMG/M
3300017702|Ga0181374_1035920All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.861Open in IMG/M
3300017705|Ga0181372_1074818All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.574Open in IMG/M
3300017715|Ga0181370_1043781All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon576Open in IMG/M
3300017731|Ga0181416_1142213All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon578Open in IMG/M
3300017738|Ga0181428_1103597All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon666Open in IMG/M
3300017753|Ga0181407_1176429All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon522Open in IMG/M
3300017775|Ga0181432_1134431All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.753Open in IMG/M
3300022164|Ga0212022_1026810All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon877Open in IMG/M
(restricted) 3300022902|Ga0233429_1070804All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon1515Open in IMG/M
(restricted) 3300022902|Ga0233429_1094348All Organisms → Viruses → Predicted Viral1226Open in IMG/M
(restricted) 3300022916|Ga0233431_1284509All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon586Open in IMG/M
(restricted) 3300023210|Ga0233412_10328098All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon679Open in IMG/M
(restricted) 3300024243|Ga0233436_1135254All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.753Open in IMG/M
3300025066|Ga0208012_1003080All Organisms → Viruses → Predicted Viral3778Open in IMG/M
3300025066|Ga0208012_1019367All Organisms → Viruses → Predicted Viral1112Open in IMG/M
3300025066|Ga0208012_1030467All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.836Open in IMG/M
3300025072|Ga0208920_1010283All Organisms → Viruses → Predicted Viral2108Open in IMG/M
3300025078|Ga0208668_1021780All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon1294Open in IMG/M
3300025082|Ga0208156_1012868All Organisms → Viruses → Predicted Viral1987Open in IMG/M
3300025084|Ga0208298_1008585All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2628Open in IMG/M
3300025085|Ga0208792_1026325All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1177Open in IMG/M
3300025085|Ga0208792_1058877All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.710Open in IMG/M
3300025096|Ga0208011_1000206All Organisms → cellular organisms → Bacteria25106Open in IMG/M
3300025118|Ga0208790_1149390All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon647Open in IMG/M
3300025122|Ga0209434_1012955All Organisms → Viruses → Predicted Viral3018Open in IMG/M
3300025131|Ga0209128_1070656All Organisms → Viruses → Predicted Viral1201Open in IMG/M
3300025141|Ga0209756_1025140All Organisms → Viruses → Predicted Viral3329Open in IMG/M
3300025141|Ga0209756_1025426All Organisms → Viruses → Predicted Viral3303Open in IMG/M
3300025168|Ga0209337_1033374All Organisms → Viruses → Predicted Viral2826Open in IMG/M
3300025168|Ga0209337_1067575All Organisms → Viruses → Predicted Viral1781Open in IMG/M
3300025168|Ga0209337_1077808All Organisms → Viruses → Predicted Viral1617Open in IMG/M
3300025168|Ga0209337_1139873All Organisms → Viruses → Predicted Viral1064Open in IMG/M
3300025168|Ga0209337_1277564Not Available623Open in IMG/M
3300025652|Ga0208134_1019116All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon2603Open in IMG/M
3300027714|Ga0209815_1138212All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.785Open in IMG/M
3300027714|Ga0209815_1274432Not Available505Open in IMG/M
3300027788|Ga0209711_10389741All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.574Open in IMG/M
3300027801|Ga0209091_10266664Not Available825Open in IMG/M
3300028188|Ga0257124_1167921Not Available573Open in IMG/M
3300028706|Ga0257115_1019054All Organisms → Viruses → Predicted Viral2524Open in IMG/M
3300031519|Ga0307488_10319705Not Available991Open in IMG/M
3300031596|Ga0302134_10230144All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.734Open in IMG/M
3300031605|Ga0302132_10051753All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2140Open in IMG/M
3300031605|Ga0302132_10477504Not Available551Open in IMG/M
3300031627|Ga0302118_10220999Not Available900Open in IMG/M
3300031659|Ga0307986_10051151All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2157Open in IMG/M
3300031675|Ga0302122_10277028All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.600Open in IMG/M
3300032088|Ga0315321_10124021All Organisms → Viruses → Predicted Viral1744Open in IMG/M
3300032138|Ga0315338_1052149All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1575Open in IMG/M
3300032138|Ga0315338_1064026All Organisms → Viruses → Predicted Viral1357Open in IMG/M
3300032138|Ga0315338_1120817All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.853Open in IMG/M
3300032138|Ga0315338_1204073Not Available576Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine68.63%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater4.90%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater4.90%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.92%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.92%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater3.92%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.94%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine1.96%
Background SeawaterEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater0.98%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.98%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.98%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.98%
Diffuse Hydrothermal Flow Volcanic VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent0.98%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300002514Marine viral communities from the Pacific Ocean - ETNP_6_85EnvironmentalOpen in IMG/M
3300002518Marine viral communities from the Pacific Ocean - ETNP_6_100EnvironmentalOpen in IMG/M
3300002519Marine viral communities from the Pacific Ocean - ETNP_2_300EnvironmentalOpen in IMG/M
3300003514Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS821_Marshmallow_DNAEnvironmentalOpen in IMG/M
3300005521Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255EnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006736Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaGEnvironmentalOpen in IMG/M
3300006751Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006926Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007510Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300007512Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007758Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDPlume_2015_DNA CLC_assemblyEnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009173Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134EnvironmentalOpen in IMG/M
3300009378Combined Assembly of Gp0137076, Gp0137077EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010155Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaGEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300017702Marine viral communities from the Subarctic Pacific Ocean - Lowphox_10 viral metaGEnvironmentalOpen in IMG/M
3300017705Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaGEnvironmentalOpen in IMG/M
3300017715Marine viral communities from the Subarctic Pacific Ocean - Lowphox_06 viral metaGEnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022902 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_135_MGEnvironmentalOpen in IMG/M
3300022916 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_200_MGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300024243 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_150_MGEnvironmentalOpen in IMG/M
3300025066Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025072Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025078Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025082Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025096Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025118Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025122Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes)EnvironmentalOpen in IMG/M
3300025131Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025141Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300028188Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_150EnvironmentalOpen in IMG/M
3300028706Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_100mEnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031596Marine microbial communities from Western Arctic Ocean, Canada - CB9_SCMEnvironmentalOpen in IMG/M
3300031605Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1EnvironmentalOpen in IMG/M
3300031627Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1EnvironmentalOpen in IMG/M
3300031659Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82EnvironmentalOpen in IMG/M
3300031675Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCMEnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M
3300032138Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #8EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI24006J15134_1006212733300001450MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVNWHNNERYEEVLSNYRELNPNGNYGRNEYRAGELFEVTLDEVNSFLNGHLDFMNSSNAESVNG*
JGI24006J15134_1008358023300001450MarineMIDKGSLVCSTFIGKLQMGTVTSRRIGDDKWAYYTVKWHDNERYEAVLDGYRNLNPNGNYGREEYKAGELFEVTPDEVNSFVNGHLDFLYSSLIPKDVVNG*
JGI24006J15134_1010346743300001450MarineIDKGSLVCSTFIGKLQMGTVTSRRVGKDKWAYYTVEWHNNEKYEEVLSNYRKLNPNGNYGRKEYKAGELFEVTSDEIISFANNHLDFINSSNTESVNG*
JGI24006J15134_1017722713300001450MarineIDKGSLVCSTFIGKLQMGTVTSRRVGKDKWAYYTVKWHDNEKYEAVLEKYRELNSKGTYGRKEYKAGELFEVTPDVVTSFVNGHLDFMNSVNSESVNG*
JGI25133J35611_1005029013300002514MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVKWHDNERYEAVLDGYRELNPNGTYGREEYRAGELFEVTPDEITSFANKHLDFLYSSIIPKDVVNG*
JGI25133J35611_1006117443300002514MarineMIDKGSLVCTTYXGKLQMGTVTSRRVGXDKWAYYTVEWHXNEKYQSTLDNYKALNPNGKYGREEYRAGELFEVAPDEVTSLVNGHLDFLYSSLIPKDVVNG*
JGI25134J35505_1000403553300002518MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEAILDGYRALNPNGIYGREEYKAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG*
JGI25130J35507_106187523300002519MarineNNMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVQWHDNEKYEAILDGYRALNPNGIYGREEYKAGELXEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG*
FS821DNA_101273043300003514Diffuse Hydrothermal Flow Volcanic VentMIDKGSLVCTTHIGKLQMGTVTSRRVGDDKWAYYKVQWHDNEKYEAILSRYRELNPNGVYGREEYRAGELFEVTASEVSSLVNGHLDFIHSCLAPKVVENG*
Ga0066862_1015000123300005521MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVQWHDNEKYQSTLDNYKALNPNGKYGREEYRAGELFEVTPDEVTSLVNGHLDFLYSSLIPKNVVNG*
Ga0075441_1007052033300006164MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYKVKWHNNEKYEEVLESYRAINTKATYGKEEYRAGELFEVTPAFITSSVNKHLDSIHSSPDDAING*
Ga0075441_1010439523300006164MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVNWHNNERYEEVLSNYRELNPNGNYGRNEYRAGELFEVTLDEVNSFLNGHLDFMNSSDTESVNG*
Ga0098033_100465893300006736MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEAILDGYRALNPNGIYGREEYKAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG*
Ga0098040_125178023300006751MarineMIDKGSLVCTTYIGKFQMGTVTSRRVGDDRWAYYTVEWHDNEKYEATLDDYRTLNPNGTYGREEYKAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG*
Ga0098044_120003923300006754MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEATLDDYRTLNPNGTYGREEYKAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG*
Ga0098054_105415043300006789MarineMIDKGSLVCSTFIGKLQMGTVTSRRVGDDKWAYYTVEWHDNERYEEVLDGYRELNPNGTYGREEYRAGELFEVTPDEITSFANKHLDFLYSSLIPKDVVNG*
Ga0098054_107873333300006789MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYQSTLDNYKALNPNGKYGREEYRAGELFEVAPDEVTSLINGHLDFLYSSLIPKDVVNG*
Ga0098054_107878033300006789MarineMIDKGSLVCSTFIGKLQMGTVTSRRIGDDKWAYYTVKWHDNERYEAVLDGYRELNPNGTYGREEYKAGELFEVTPDEVNSFVNGHLDFLYSSLIPKDVVNG*
Ga0098054_107924613300006789MarineNNMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEATLDGYRALNPNGTYGREEYKAGELFEVTPDEVTSLINGHLDFLYSSFIPKDVING*
Ga0098054_112057343300006789MarineNNMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEATLDGYRTLNPNGKYGREEYRAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG*
Ga0098055_102702253300006793MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYQSTLDNYKALNPNGKYGREEYRAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG*
Ga0098055_110145343300006793MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEATLDGYRTLNPNGKYGREEYRAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG*
Ga0098055_132278213300006793MarineIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEAILDGYRALNPNGIYGREEYKAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG*
Ga0098051_103326923300006924MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVEWHDNERYEEVLDGYRELNPNGTYGREEYRAGELFEVTPDEITSFANKHLDFLYSSLIPKDVVNG*
Ga0098051_104607413300006924MarineNNMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEATLDGYRALNPNGTYGREEYKAGELFEVTPDEVTSLINGHLDFLYSSFISKDVING*
Ga0098050_103040053300006925MarineMIDKGSLVCTAYIGKLQMGTVTSRRVGDDRWAYYTVEWHDNERYEEVLDGYRELNPNGTYGREEYRAGELFEVTPDEITSFANKHLDFLYSSLIPKDVVNG*
Ga0098050_105292013300006925MarineSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEATLDGYRALNPNGTYGREEYKAGELFEVTPDEVTSLINGHLDFLYSSFISKDVING*
Ga0098057_102550533300006926MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYQSTLDNYKALNPNGKYGRGEYRAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG*
Ga0098046_108409623300006990MarineIGKLQMGTVTSRRVGDDKWAYYTVEWHDNERYEEVLDGYRELNPNGTYGREEYRAGELFEVTPDEITSFANKHLDFLYSSLIPKDVVNG*
Ga0075468_1000159593300007229AqueousMIDKGSLVCSTFIGKLQMGTVTSRRIGEDKWAYYTVEWHDNERYESVLDGYRELNPNGKYGREEYRAGELFEVTPDEVNSFVNGHLDFLYSSLIPKDVVNG*
Ga0070747_116300313300007276AqueousMIERENIIKQENNMIDEGSLVCSTYVGKLQMGTVSSRRVGDDKWAYYTVEWHDNDKYEAIQKGYRELNPNGVYGRTEYRAGEIFEVSPDQVTKLVNEHLDFLYSSFIPKDVVNG*
Ga0105013_118053623300007510MarineMIDKGSLVCTTYIGKLQMGTVTSRTVGDDKWARYTVEWHDNEKYEAILDNYRELNPNGVYGKEIYKAGELFEVTPDQVTSLVNGHLDFLYSTFIPKDVVNG*
Ga0105016_104042953300007512MarineMIDKGSLVCTTYIGKLQMGTVTSRTVGDDKWARYTVEWHDNEKYEAILDNYRELNPNGVYGKEIYKAGELFEVTPDQVTSLVNGHLDFLYSTSIPKDVVNG*
Ga0105668_101181533300007758Background SeawaterVIGKIYHYKQEKKMIDKGSLVCTTHIGKLQMGTVTSRRVGDDKWAYYKVQWHDNEKYEAILSRYRELNPNGVYGREEYRAGELFEVTASEVSSLVNGHLDFIHSCLAPKVVENG*
Ga0098052_120983923300008050MarineSLVCTTFIGKLQMGTVTSRRAGDDKWAYYTVEWHDNERYEEVLDGYRELNPNGTYGREEYRAGELFEVTPDEITSFANKHLDFLYSSLIPKDVVNG*
Ga0098052_133985523300008050MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEATLDGYRALNPNGTYGREEYKAGELFEVTPDEVTSLINGHLDFLYSSLIPKDVVNG*
Ga0115566_1022319823300009071Pelagic MarineMIDKGSLVCSTYVGKLQMGTVTSRRIGDDKWAYYTVEWHDNEKYESVLDGYRKLNPNGKYGREEYRAGELFEVTPDEVTSLVNGHLDFLYSSFIPKDVING*
Ga0114996_1012219433300009173MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGKDKWAYYKVKWHDNEKYEAVLERYRELNSKGTYGREEYKAGELFEVTPDSVTSFVNGHLDFVHSSSDDAING*
Ga0118726_107749833300009378MarineMIDKGSLVCTTYIGKLQMGTVTSRTVGDDKWARYTVEWHDNEKYEAILDNYRELNPNGAYGKEIYKAGELFEVTPDQVTSLVNGHLDFLYSTSIPKDVVNG*
Ga0114997_1015322823300009425MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGKDKWAYYKVKWHDNEKYEAVLERYRELNSKGTYGREEYKAGELFEVTPDSVTSFVNGHLDFIHSSSDDVING*
Ga0115000_1023658823300009705MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGKDKWAYYKVKWHDNEKYEAVLERYRELNSKGTYGREEYKAGELFEVTPDSVTSFVNGHLDFIHSSSDDAING*
Ga0115000_1028135233300009705MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYKVKWHDNEKYEEILSGYRTMNRKGTYGREEYRAGELLEITTAIITSSVNKHLDFTHSSSDDTING*
Ga0115001_1026448513300009785MarineKGSLVCTTFVGKLQMGTVTSRRVGKDKWAYYKVKWHDNEKYEAVLERYRELNSKGTYGREEYKAGELFEVTPDSVTSFVNGHLDFIHSSDTESVNG*
Ga0114999_1055415623300009786MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGKDKWAYYKVKWHDNEKYEAVLERYRTLNSKGTYGREEYKAGELFEVTPDSVTSFVNGHLDFVHSSSDDAING*
Ga0098049_104038823300010149MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNERYEEVLDGYRELNPNGTYGREEYRAGELFEVTPDEITSFANKHLDFLYSSLIPKDVVNG*
Ga0098056_112041123300010150MarineMIDKGSLVCSTFIGKLQMGTVTSRRIGDDKWAYYTVKWHDNERYEAVLDGYRELNPNGTYGREEYKAGELFEVTPDEITSFANKHLDFLYSSLIPKDVVNG*
Ga0098056_126209423300010150MarineTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEAILDGYRALNPNGIYGREEYKAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG*
Ga0098059_141028013300010153MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYQSTLDNYKALNPNGKYGREEYRAGELFEVAPDEVTSLVNGHLDFLYSSLIPKDVVNG*
Ga0098047_1008305013300010155MarineHVILYTIGRNIIIKQENNMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYQSTLDNYKALNPNGKYGRGEYRAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG*
Ga0133547_1153419843300010883MarineMGTVTSRRVGDDKWAYYKVKWHDGEKYEEILSGYRTMNRKGTYGREEYKAGELFEVTPDVVTSFVNGHLDFIHSSSDDENNG*
Ga0181374_103592013300017702MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEAILDGYRALNPNGIYGREEYKAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG
Ga0181372_107481813300017705MarineRGEMLVCTLGAGHFQMGTVMSRRIGDNKWAYYTVKWHDNERYEAVLDGYRNLNPNGNYGREEYKAGELFEVTPDEITSFANKHLDFLYSSLIPKDVVNG
Ga0181370_104378113300017715MarineIGRNIIIKQENNMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYQSTLDNYKALNPNGKYGREEYRAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG
Ga0181416_114221313300017731SeawaterEGNIIIKQENNMIDKGSLVCSTFIGKLQMGTVASRRVGDDNWAYYTVEWHDNERYEEVLDGYRELNPNGTYGREEYRAGELFEVTPDEITSFANKHLDFLYSSLIPKDVVNG
Ga0181428_110359723300017738SeawaterMIDKGSLVCSTFIGKLQMGTVASRRVGDDNWAYYTVEWHDNERYEEVLDGYRELNPNGTYGREEYRAGELFEVTPDEITSFANKHLDFLYSSLIPKDVVNG
Ga0181407_117642923300017753SeawaterMIDEGSLVCSTYVGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEEVLNEYKNLNPNGTYGREEYRAGELFEVTPDEITSFANKHLDFLYSSLIPKDVVNG
Ga0181432_113443113300017775SeawaterTFIGKLQMGTVTSRRIAKNKWAYYTVEWHNNEKYEEVLSNYRKLNPNGNYGRKEYKAGELFEVTSDEIISFANKHLDFINSSNTESVNG
Ga0212022_102681023300022164AqueousMIDKGSLVCSTFIGKLQMGTVTSRRIGEDKWAYYTVEWHDNERYESVLDGYRELNPNGKYGREEYRAGELFEVTPDEVNSFVNGHLDFLYSSLIPKDVVNG
(restricted) Ga0233429_107080413300022902SeawaterMIDKGSLVCTTYIGKLQMGTVTSRRVGDDRWAYYTVEWHDNEKYQSTLDNYKALNPNGTYGREEYKAGELFEVTPDEVTSLVNGHLDFLYSSFIPKDVING
(restricted) Ga0233429_109434833300022902SeawaterMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEAILDGYRALNPNGIYGREEYKAGELFEVTPDEVTSLVNGHLDFLYSS
(restricted) Ga0233431_128450913300022916SeawaterMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEAILDGYRALNPNGIYGREEYKAGELFEVTPDEVTSLVNGHLDFLYSSFIPKDVING
(restricted) Ga0233412_1032809823300023210SeawaterMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEAILDGYRALNPNGIYGREEYKAGELFEVTPDEVSSLVNGHLDFLYSSLI
(restricted) Ga0233436_113525413300024243SeawaterMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEAILDGYRALNPNGIYGREEYKAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG
Ga0208012_100308053300025066MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYQSTLDNYKALNPNGKYGREEYRAGELFEVAPDEVTSLINGHLDFLYSSLIPKDVVNG
Ga0208012_101936723300025066MarineMIDKGSLVCSTFIGKLQMGTVTSRRIGDDKWAYYTVKWHDNERYEAVLDGYRELNPNGTYGREEYKAGELFEVTPDEVNSFVNGHLDFLYSSLIPKDVVNG
Ga0208012_103046733300025066MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEATLDDYRTLNPNGTYGREEYKAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG
Ga0208920_101028333300025072MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYQSTLDNYKALNPNGKYGREEYRAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG
Ga0208668_102178043300025078MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYQSTLDNYKALNPNGKYGREEYRAGELFEVAPDEVTSLVNGHLDFLYSSLIPKDVVNG
Ga0208156_101286843300025082MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEAILDGYRALNPNGIYGREEYKAGELFEVTPDEVTSLVNGHLDFLYSSLISKDVVNG
Ga0208298_100858563300025084MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEATLDGYRTLNPNGKYGREEYRAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG
Ga0208792_102632513300025085MarineLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEATLDGYRALNPNGTYGREEYKAGELFEVTPDEVTSLINGHLDFLYSSFISKDVING
Ga0208792_105887723300025085MarineTVTSRRVGDDRWAYYTVEWHDNERYEEVLDGYRELNPNGTYGREEYRAGELFEVTPDEITSFANKHLDFLYSSLIPKDVVNG
Ga0208011_1000206103300025096MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDRWAYYTVEWHDNERYEEVLDGYRELNPNGTYGREEYRAGELFEVTPDEITSFANKHLDFLYSSLIPKDVVNG
Ga0208790_114939023300025118MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEATLDDYRTLNPNGTYGREEYKAGELFEVTPDEVTSLVNGHLDFLYSSLIPK
Ga0209434_101295553300025122MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVQWHDNEKYEAILDGYRALNPNGIYGREEYKAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG
Ga0209128_107065633300025131MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYQSTLDNYKALNPNGKYGREEYRAGELFEVTPDEVTSLVNGHLDFLYSS
Ga0209756_102514043300025141MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYQSTLDNYKALNPNGKYGREEYRAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG
Ga0209756_102542653300025141MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVKWHDNERYEAVLDGYRELNPNGTYGREEYRAGELFEVTPDEITSFANKHLDFLYSSIIPKDVVNG
Ga0209337_103337423300025168MarineMIDKGSLVCSTFIGKLQMGTVTSRRIGDDKWAYYTVKWHDNERYEAVLDGYRNLNPNGNYGREEYKAGELFEVTPDEVNSFVNGHLDFLYSSLIPKDVVNG
Ga0209337_106757523300025168MarineMIDKGSLVCSTFIGKLQMGTVTSRRVGKDKWAYYTVKWHDNEKYEAVLEKYRELNSKGTYGRKEYKAGELFEVTPDVVTSFVNGHLDFMNSVNSESVNG
Ga0209337_107780823300025168MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVNWHNNERYEEVLSNYRELNPNGNYGRNEYRAGELFEVTLDEVNSFLNGHLDFMNSSNAESVNG
Ga0209337_113987343300025168MarineMGTVTSRRVGDDKWAYYTVNWHNNERYEEVLSNYRELNPKGNYGRNEYRAGELFEVTLDEVNSFLNGHLDFMNSSNTESVNG
Ga0209337_127756413300025168MarineMIDKGSLVCTLGAGHFQMGTVTSRRIGDDKWAYCTVEWHDNEKYEMVLDNYRELNSSGTYGRKEYRAGELFEVTPNEITSFVNGHLDFLYSSPKVVVNG
Ga0208134_101911623300025652AqueousMIDEGSLVCSTYVGKLQMGTVSSRRVGDDKWAYYTVEWHDNDKYEAIQKGYRELNPNGVYGRTEYRAGEIFEVSPDQVTKLVNEHLDFLYSSFIPKDVVNG
Ga0209815_113821223300027714MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVNWHNNERYEEVLSNYRELNPNGNYGRNEYRAGELFEVTLDEVNSFLNGHLDFMNSSDTESVNG
Ga0209815_127443223300027714MarineMIDKGSLVCTTFIGKLQMGTVTSRRIAANKWAYYKVKWHDNEKYEAVLERYRELNSKGTYGREEYKAGELFEVTPDIVTSFVNGHLDFINSSDTESVNG
Ga0209711_1038974113300027788MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGKDKWAYYKVKWHDNEKYEAVLERYRTLNSKGTYGREEYKAGELFEVTPDSVTSFVNGHLDFVHSSSDDAING
Ga0209091_1026666423300027801MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGKDKWAYYKVKWHDNEKYEAVLERYRELNSKGTYGREEYKAGELFEVTPDSVTSFVNGHLDFIHSSSDDAING
Ga0257124_116792113300028188MarineMIDKGSLVCSTFIGKLQMGTVTSRRVGKDKWAYYTVEWHNNEKYEEVLSNYRKLNPNGNYGRKEYKAGELFEVTPDEVNSFVNGHLDFLYSSLIPKDVVNG
Ga0257115_101905413300028706MarineMIERVIIIKQENNMIDKGSLVCTTFIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEAILDGYRALNPNGIYGREEYKAGELFEVTPDEVTSLVNGHLDFLYSSFIPKDVING
Ga0307488_1031970533300031519Sackhole BrineMIDKGSLVCTTFIGKLQMGTVTSRRVGKDKWAYYTVEWHDGDRYEAVLDNYRKLNSKGTYGRKEYRAGELFEVTPDSVTSFLNG
Ga0302134_1023014423300031596MarineMIDKGSLVCTTFTGKLQMGTVTSRRVDKDKWAYYTVEWHDSERYEAVLDNYRKLNSKGTYGRKEYRAGELFEVTPDSVTSFLNGHLDFLYSSITPKDVVNG
Ga0302132_1005175333300031605MarineMIDKGSLVCTTFVGKLQMGTVTSRRVGDDKWAYYKVKWHDNEKYEAVLERYRTLNSKGTYGREEYKAGELFEVTPDSVTSFVNGHLDFVHSSSDDAING
Ga0302132_1047750413300031605MarineMIDKGSLVCTTFTGKLQMGTVTSRRVDKDKWAYYTVEWHDSERYEAVLDNYRKLNSKGTYGRKEYRAGELFEATPDSVTSFLNG
Ga0302118_1022099923300031627MarineMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYKVKWHDGEKYEEILSGYRTMNRKGTYGREEYKAGELFEVTPDVVTSFVNGHLDFIHSSSDDENNG
Ga0307986_1005115143300031659MarineMIDKGSLVCTTFIGKLQMGTVTSRRVGDDRWAYYKVKWHNNEKYEEILNNYRALNSKATYGKEEYRAGELFEVTPTTVTSSVNEHLDFIHSSSDDVTNG
Ga0302122_1027702813300031675MarineVCTTFIGKLQMGTVTSRRVGDDKWAYYKVKWHDNEKYEAVLERYRTLNSKGTYGREEYKAGELFEVTPDSVTSFVNGHLDFVHSSSDDAING
Ga0315321_1012402153300032088SeawaterMIDEGSLVCSTYVGKIQMGTVTSRRVGDDKWAYYTVEWHDNEKYEAVLDGYRELNPNGTYGREEYRAGELFEVTPDQVTSLVNGHLDFLYSSFVAKDVVNG
Ga0315338_105214933300032138SeawaterMIDKGSLVCTTYIGKFQMGTVTSRRVGDDRWAYYTVEWHDNEKYEATLDDYRTLNPNGTYGREEYKAGELFEVTPDEVTSLVNGHLDFLYSSLIPKDVVNG
Ga0315338_106402613300032138SeawaterERNIIIKQENNMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEATLDGYRTLNPNGKYGREEYRAGELFEVTPDEVTSLVNGHLDFLYSSLIPKNVVNG
Ga0315338_112081723300032138SeawaterMIDKGSLVCTTYIGKLQMGTVTSRRVGDDKWAYYTVEWHDNEKYEAILDGYRALNPNGIYGREEYKAGELFEVTVSNISSSMNEHLDFINSSNTESVNG
Ga0315338_120407323300032138SeawaterMIDKGSLVCSTFIGKLQMGTVTSRRVGKDKWAYYTVEWHNNEKYEEVLSNYRKLNPNGNYGRKEYKAGELFEVTSDEIISFANNHLDFINSSNTESVNG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.