NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101868

Metagenome / Metatranscriptome Family F101868

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101868
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 53 residues
Representative Sequence MEVMILNGRRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKIR
Number of Associated Samples 82
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 3.92 %
% of genes near scaffold ends (potentially truncated) 24.51 %
% of genes from short scaffolds (< 2000 bps) 85.29 %
Associated GOLD sequencing projects 69
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (40.196 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(29.412 % of family members)
Environment Ontology (ENVO) Unclassified
(69.608 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(77.451 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 18.87%    β-sheet: 20.75%    Coil/Unstructured: 60.38%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF13619KTSC 1.96
PF04404ERF 0.98
PF04542Sigma70_r2 0.98
PF01510Amidase_2 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.98
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.98
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.98
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms59.80 %
UnclassifiedrootN/A40.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10056718All Organisms → Viruses → Predicted Viral1913Open in IMG/M
3300000101|DelMOSum2010_c10067403All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1672Open in IMG/M
3300000101|DelMOSum2010_c10074612All Organisms → Viruses → Predicted Viral1539Open in IMG/M
3300000101|DelMOSum2010_c10234286All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium589Open in IMG/M
3300000159|LPaug08P2610mDRAFT_c1032672All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium517Open in IMG/M
3300000930|BpDRAFT_10052864All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium904Open in IMG/M
3300001450|JGI24006J15134_10043266All Organisms → Viruses → Predicted Viral1891Open in IMG/M
3300001450|JGI24006J15134_10124757All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium882Open in IMG/M
3300001450|JGI24006J15134_10174517Not Available680Open in IMG/M
3300001450|JGI24006J15134_10180544All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium662Open in IMG/M
3300001450|JGI24006J15134_10197190Not Available617Open in IMG/M
3300001460|JGI24003J15210_10090953Not Available897Open in IMG/M
3300001472|JGI24004J15324_10028492All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1837Open in IMG/M
3300001472|JGI24004J15324_10159764All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium512Open in IMG/M
3300001718|JGI24523J20078_1008500All Organisms → Viruses → Predicted Viral1457Open in IMG/M
3300001720|JGI24513J20088_1009604All Organisms → Viruses → Predicted Viral1213Open in IMG/M
3300003878|Ga0063282_1098156Not Available970Open in IMG/M
3300004279|Ga0066605_10021597All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon3192Open in IMG/M
3300004461|Ga0066223_1056498Not Available648Open in IMG/M
3300005590|Ga0070727_10423221All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium743Open in IMG/M
3300005600|Ga0070726_10233402Not Available934Open in IMG/M
3300006029|Ga0075466_1042323All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1373Open in IMG/M
3300006164|Ga0075441_10334684All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium551Open in IMG/M
3300006191|Ga0075447_10003682Not Available6821Open in IMG/M
3300006399|Ga0075495_1458442Not Available1206Open in IMG/M
3300006467|Ga0099972_10244021Not Available908Open in IMG/M
3300006803|Ga0075467_10596216All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium565Open in IMG/M
3300006810|Ga0070754_10532638All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium503Open in IMG/M
3300006916|Ga0070750_10135302Not Available1124Open in IMG/M
3300006947|Ga0075444_10261957Not Available677Open in IMG/M
3300007555|Ga0102817_1002475All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon4644Open in IMG/M
3300007655|Ga0102825_1011826Not Available1805Open in IMG/M
3300007758|Ga0105668_1126658All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1102Open in IMG/M
3300007956|Ga0105741_1115103All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium657Open in IMG/M
3300007972|Ga0105745_1074826All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium966Open in IMG/M
3300007973|Ga0105746_1072726Not Available1104Open in IMG/M
3300007974|Ga0105747_1069447All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1065Open in IMG/M
3300008996|Ga0102831_1060167Not Available1269Open in IMG/M
3300008999|Ga0102816_1016405Not Available2119Open in IMG/M
3300009172|Ga0114995_10089893All Organisms → Viruses → Predicted Viral1726Open in IMG/M
3300009428|Ga0114915_1050811Not Available1337Open in IMG/M
3300009432|Ga0115005_11171587Not Available625Open in IMG/M
3300009512|Ga0115003_10808055All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium545Open in IMG/M
3300009785|Ga0115001_10222748All Organisms → Viruses → Predicted Viral1214Open in IMG/M
3300011118|Ga0114922_10257509All Organisms → Viruses → Predicted Viral1462Open in IMG/M
3300017728|Ga0181419_1165953Not Available525Open in IMG/M
3300017746|Ga0181389_1054086All Organisms → Viruses → Predicted Viral1165Open in IMG/M
3300017746|Ga0181389_1057651Not Available1120Open in IMG/M
3300017772|Ga0181430_1127955All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium745Open in IMG/M
3300020165|Ga0206125_10292910Not Available611Open in IMG/M
3300020335|Ga0211690_1037600Not Available1152Open in IMG/M
3300020358|Ga0211689_1018128All Organisms → Viruses → Predicted Viral2384Open in IMG/M
3300020385|Ga0211677_10271525Not Available684Open in IMG/M
3300020388|Ga0211678_10211527All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium810Open in IMG/M
3300020438|Ga0211576_10413344All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium689Open in IMG/M
3300021859|Ga0210334_10875668Not Available510Open in IMG/M
3300022061|Ga0212023_1019632All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium913Open in IMG/M
3300022201|Ga0224503_10317229Not Available518Open in IMG/M
3300022306|Ga0224509_10214654All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium690Open in IMG/M
(restricted) 3300023210|Ga0233412_10046233All Organisms → Viruses → Predicted Viral1765Open in IMG/M
(restricted) 3300024517|Ga0255049_10176237Not Available976Open in IMG/M
3300025048|Ga0207905_1011185All Organisms → Viruses → Predicted Viral1563Open in IMG/M
3300025048|Ga0207905_1013284All Organisms → Viruses → Predicted Viral1412Open in IMG/M
3300025048|Ga0207905_1021444All Organisms → Viruses → Predicted Viral1074Open in IMG/M
3300025071|Ga0207896_1010315Not Available1671Open in IMG/M
3300025071|Ga0207896_1013918All Organisms → Viruses → Predicted Viral1424Open in IMG/M
3300025084|Ga0208298_1002391Not Available6268Open in IMG/M
3300025120|Ga0209535_1007189Not Available6631Open in IMG/M
3300025120|Ga0209535_1116334Not Available920Open in IMG/M
3300025120|Ga0209535_1200144All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium563Open in IMG/M
3300025137|Ga0209336_10112068All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium757Open in IMG/M
3300025138|Ga0209634_1281582Not Available583Open in IMG/M
3300025237|Ga0208031_1022432All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium847Open in IMG/M
3300025266|Ga0208032_1001385Not Available10507Open in IMG/M
3300025276|Ga0208814_1026541All Organisms → Viruses → Predicted Viral1876Open in IMG/M
3300025276|Ga0208814_1062824All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1040Open in IMG/M
3300025645|Ga0208643_1000119Not Available50870Open in IMG/M
3300025705|Ga0209374_1005058Not Available9208Open in IMG/M
3300027077|Ga0208941_1003960All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2266Open in IMG/M
3300027186|Ga0208797_1006171Not Available1796Open in IMG/M
3300027190|Ga0208674_1015734All Organisms → Viruses → Predicted Viral1204Open in IMG/M
3300027196|Ga0208438_1048225All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium705Open in IMG/M
3300027668|Ga0209482_1060430Not Available1339Open in IMG/M
3300027704|Ga0209816_1020027All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon3569Open in IMG/M
3300027742|Ga0209121_10175808Not Available793Open in IMG/M
3300027752|Ga0209192_10125424All Organisms → Viruses → Predicted Viral1036Open in IMG/M
3300027757|Ga0208671_10201118All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium716Open in IMG/M
3300027758|Ga0209379_10123984All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium920Open in IMG/M
3300027758|Ga0209379_10256118Not Available593Open in IMG/M
3300027791|Ga0209830_10011250All Organisms → cellular organisms → Bacteria5642Open in IMG/M
3300031519|Ga0307488_10018937All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium5565Open in IMG/M
3300031519|Ga0307488_10232406Not Available1227Open in IMG/M
3300031519|Ga0307488_10388114Not Available867Open in IMG/M
3300031519|Ga0307488_10446884All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium786Open in IMG/M
3300031519|Ga0307488_10835470Not Available506Open in IMG/M
3300031569|Ga0307489_10451646All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium865Open in IMG/M
3300031622|Ga0302126_10035928All Organisms → Viruses → Predicted Viral2153Open in IMG/M
3300031628|Ga0308014_1105191All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium654Open in IMG/M
3300031638|Ga0302125_10179569Not Available662Open in IMG/M
3300031688|Ga0308011_10267612All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium514Open in IMG/M
3300031700|Ga0302130_1040400All Organisms → Viruses → Predicted Viral1542Open in IMG/M
3300031848|Ga0308000_10173451All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium812Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine29.41%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine11.76%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine8.82%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.86%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine5.88%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean4.90%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment3.92%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water3.92%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine3.92%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater3.92%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.94%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.96%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.96%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.98%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.98%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.98%
Background SeawaterEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater0.98%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.98%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.98%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.98%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.98%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.98%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine0.98%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000159Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 10mEnvironmentalOpen in IMG/M
3300000930Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16mEnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001718Marine viral communities from the Pacific Ocean - LP-48EnvironmentalOpen in IMG/M
3300001720Marine viral communities from the Pacific Ocean - LP-36EnvironmentalOpen in IMG/M
3300003878Plastic marine debris microbial communities from the Atlantic Ocean - SEA_0142_20120611_metagenEnvironmentalOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005600Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006191Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNAEnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007655Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579EnvironmentalOpen in IMG/M
3300007758Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDPlume_2015_DNA CLC_assemblyEnvironmentalOpen in IMG/M
3300007956Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2umEnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020335Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX556030-ERR599035)EnvironmentalOpen in IMG/M
3300020358Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009)EnvironmentalOpen in IMG/M
3300020385Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965)EnvironmentalOpen in IMG/M
3300020388Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300021859Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022061Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2)EnvironmentalOpen in IMG/M
3300022201Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022306Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24EnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300024517 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3EnvironmentalOpen in IMG/M
3300025048Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes)EnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025237Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 (SPAdes)EnvironmentalOpen in IMG/M
3300025266Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025705Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m (SPAdes)EnvironmentalOpen in IMG/M
3300027077Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C27A4_35 (SPAdes)EnvironmentalOpen in IMG/M
3300027186Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes)EnvironmentalOpen in IMG/M
3300027190Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 (SPAdes)EnvironmentalOpen in IMG/M
3300027196Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027704Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027742Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300027758Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031628Marine microbial communities from water near the shore, Antarctic Ocean - #229EnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031688Marine microbial communities from water near the shore, Antarctic Ocean - #177EnvironmentalOpen in IMG/M
3300031700Marine microbial communities from Western Arctic Ocean, Canada - CB9_surfaceEnvironmentalOpen in IMG/M
3300031848Marine microbial communities from water near the shore, Antarctic Ocean - #3EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1005671873300000101MarineMEVLVINGRRYLINTSTQDGGDSICEWLLKQFKDEPVLDWDQPKQSDFTNKIR*
DelMOSum2010_1006740333300000101MarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKIR*
DelMOSum2010_1007461233300000101MarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKIRL*
DelMOSum2010_1023428633300000101MarineMEVMILNGRRYLINTQVTDGGDYQCEHLLKQFPDDVEINWDEVKLSDFTNKIR*
LPaug08P2610mDRAFT_103267223300000159MarineMILNGKRYLINTQTHDGGDHQCEYLLKQFSDDVEIDWDEVKLSDFTNKIRL*
BpDRAFT_1005286413300000930Freshwater And MarineRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNXXXXXXXXX*
JGI24006J15134_1004326663300001450MarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWGEVKLSDFTNKIR*
JGI24006J15134_1012475733300001450MarineMEVLIINGRRYLINTSTPDGGDSICEWLLKQFRDEPELDWDTPKLSDFTNKIR*
JGI24006J15134_1017451733300001450MarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPSDVEVDWDEVKLSDFTNKIR*
JGI24006J15134_1018054423300001450MarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPLDVEVDWDEVKPSDFTNKIRL*
JGI24006J15134_1019719013300001450MarineMEVMILNGKRYLINTQTHDGGDXQCEYLLKQFSDDVEIDWDEVKLSDFTNKIRL*
JGI24003J15210_1009095353300001460MarineMEVLIINGRRYLINTSTPDGGDSICEWLIKQFRDEPELDWDTPKLSDFTNKIR*
JGI24004J15324_1002849263300001472MarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKDTITTG*
JGI24004J15324_1015976423300001472MarineMEVLIINGRRYLINTSTPDGGDSICEWLLKQFKDEPVLDWDHPKPSDFTNKIR*
JGI24523J20078_100850043300001718MarineMEVLIINGRRYLINTSTPDGGDSICEWLXKQFRDEPELDWDTPKLSDFTNKIR*
JGI24513J20088_100960413300001720MarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFSDDVEIDWDEVKLSDFTNKIRL*
Ga0063282_109815653300003878MarineMEVMILNGRRYLINTQTHDGGDHQCEYLLKQFPPDVEVDWDEVKLSDFTNKIRL*
Ga0066605_1002159733300004279MarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEAKLSDFTNKIR*
Ga0066223_105649833300004461MarineMDVPSKPSKNYCLVEVLIINGRRYLINTSTPDGGDSICEWLLKQFRDEPELDWDTPKLSDFTNK
Ga0070727_1042322113300005590Marine SedimentVDVPSEPSKNYCLMEVLVINGRRYLINTSTQDGGDSICEWLLKQFKDEPVLDWDQPKQSDFTNKIR*
Ga0070726_1023340263300005600Marine SedimentMEVLVINGRRYLINTSTQDGGDSICEWLLKQFKDEPVLDWDQPK
Ga0075466_104232363300006029AqueousNGRRYLINTSTQDGGDSICEWLLKQFKDEPVLDWDQPKQSDFTNKIR*
Ga0075441_1033468413300006164MarineMQVMILNGERYLINTQTHDGGDQQCDHLLKQFPDNVEIDWDEVKSSDFTSKIRL*
Ga0075447_10003682103300006191MarineMEVLIINGRRYLINTSTSDGGDSICEWLLKQFKDEPVLDWDTPKLSDFTNKIR*
Ga0075495_145844223300006399AqueousMEVLVINGRRYLINTSTQDGGDSICEWLLKQFKDEPVLDWDQPKPSFYKQNTIITG*
Ga0099972_1024402113300006467MarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPPDVEVDWDEVKLSDFTNKIRL*
Ga0075467_1059621633300006803AqueousRMDVPSEPSKNYCLMEVLVINGRRYLINTSTQDGGDSICEWLLKQFKDEPVLDWDQPKPSDFTNKIR*
Ga0070754_1053263813300006810AqueousPSKNYCLMEVLVINGRRYLINTSTQDGGDSICEWLLKQFKDEPVLDWDQPKPSDFTNKIR
Ga0070750_1013530253300006916AqueousPSKPSKNYCVMEVLVINGRRYLINTSTQDGGDSICEWLLKQFKDEPVLDWDQPKQSDFTNKIR*
Ga0075444_1026195733300006947MarineMEVLIINGRRYLINTSTPDGGDSICEWLLKQFKDEPVLDWDTPKLSDFTNKIR*
Ga0102817_1002475143300007555EstuarineMEVMILNGRRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKVR*
Ga0102825_101182623300007655EstuarineMEVMILNGRRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKIR*
Ga0105668_112665833300007758Background SeawaterMEVLVINGRRYLINTSTQDGGDSICEWLLKQFKDEPVIDWDQPKLSDFTNKIR*
Ga0105741_111510313300007956Estuary WaterRYLINTQTHDGGDHQCEYLLKQFPDNVEIDWDEVKLSDFTNKIR*
Ga0105745_107482633300007972Estuary WaterMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPDNVEIDWDEVKLSDFTNKIR*
Ga0105746_107272613300007973Estuary WaterDVSSEPSKNYCLMEVLVINGRRYLINTSTQDGGDSICEWLLKQFKDEPVLDWDQPKQSDFTNKIR*
Ga0105747_106944743300007974Estuary WaterMEVMILNGKRYLINTQTYDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKIR*
Ga0102831_106016753300008996EstuarineMEVLVINGRRYLINTSTQDGGDSICEWLLKQFKDEPVLDWDQPKPSDFTNKIR*
Ga0102816_101640543300008999EstuarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKVR*
Ga0114995_1008989373300009172MarineMEVLIINGRRYLINTSTPDGGDSICEWLLKQFRDEPELDWGTPKLSDFTNKIR*
Ga0114915_105081113300009428Deep OceanMEVMILNGERYLINTQTHDGGDHQCDYLIKQFPDDVEIDWDEVKHSDFTNKIRL*
Ga0115005_1117158723300009432MarineMEVMILNGRRYLINTQTHDGGDHQCEYLLKQFPSDVEVDWDEVKLSDFTNKIRL*
Ga0115003_1080805523300009512MarineMEVMILNGRRYLINTQTHDGGDHQCEYLLKQFPSDVEVDWDEVKLSDFTNKIR*
Ga0115001_1022274823300009785MarineMEVLIINGRRYLINTSTPDGGDSVCEWLIKQFRDEPELDWDTPKLSDFTNKIR*
Ga0114922_1025750963300011118Deep SubsurfaceMEVMILNGRRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKIRL*
Ga0181419_116595323300017728SeawaterMEVLVINGRRYLINTSTQDGGDSICEWLLKQFKDEPVLDWDQPKPSDFTNK
Ga0181389_105408643300017746SeawaterMEVIILNGKRYLINTQVTDGGDHQCEHLLKQFPDDVEIDWDEVKLSDFTNKIR
Ga0181389_105765143300017746SeawaterMEVLVINGRRYLINTSTQDGGDSICEWLLKQFKDEPVLDWDQPKPSD
Ga0181430_112795513300017772SeawaterLMEVMILNGRRYLINTQVTDGGDYQCEHLLKQFPDDVEIDWDEVKLSDFTNKIR
Ga0206125_1029291023300020165SeawaterMEVMILNGRRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKIRL
Ga0211690_103760063300020335MarineGERYLINTQTHDGGDHQCDYLIKQFPDDVEIDWDEVKHSDFTNKIRL
Ga0211689_101812863300020358MarineMEVMILNGERYLINTQTHDGGDHQCDYLIKQFPDDVEIDWDEVKHSDFTNKIRL
Ga0211677_1027152523300020385MarineMEVMILNGRRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEAKLSDFTNEIRL
Ga0211678_1021152713300020388MarineINGRRYLINTQVTDGGDYQCEHLLKQFPPDAEIDWDEAKPSDFTNEIRL
Ga0211576_1041334443300020438MarineKRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKIR
Ga0210334_1087566823300021859EstuarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKIR
Ga0212023_101963243300022061AqueousMEVLVINGRRYLINTSTQDGGDSICEWLLKQFKDEPVLDWDQPKQSDFTNKIR
Ga0224503_1031722923300022201SedimentMEVMILNGRRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKIR
Ga0224509_1021465423300022306SedimentMEVMILNGRRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKVR
(restricted) Ga0233412_1004623343300023210SeawaterMEVMILNGRRYLINTQTHDGGDHQCEYLLKQFPPDVEVDWDEVKPSDFTNKIRL
(restricted) Ga0255049_1017623753300024517SeawaterRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKIR
Ga0207905_101118553300025048MarineMEVLIINGRRYLINTSTPDGGDSICEWLLKQFRDEPELDWDTPKLSDFTNKIR
Ga0207905_101328463300025048MarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPLDVEVDWDEVKP
Ga0207905_102144443300025048MarineMEVLIINGRRYLINTSTPDGGDSICEWLIKQFRDEPELDWDTPKLSDFTNKIR
Ga0207896_101031523300025071MarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWGEVKLSDFTNKIR
Ga0207896_101391833300025071MarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFSDDVEIDWDEVKLSDFTNKIRL
Ga0208298_100239163300025084MarineMEILIINGRRYLINTQVTDGGDYQCEHLLKQFPPDAEIDWDEAKPSDFTNEIRL
Ga0209535_1007189113300025120MarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPLDVEVDWDEVKSSDFTNKIRL
Ga0209535_111633423300025120MarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPEDVEIDWDEVKLSDFTNKIR
Ga0209535_120014423300025120MarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPSDVEVDWDEVKLSDFTNKIR
Ga0209336_1011206833300025137MarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPPDVEVDWDEVKLSDFTNKIRL
Ga0209634_128158213300025138MarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPPDVEVDWDEVKPSDFTNKIRL
Ga0208031_102243243300025237Deep OceanMQVMILNGERYLINTQTHDGGDQQCDHLLKQFPDNVEIDWDEVKSSDFTSKIRL
Ga0208032_1001385213300025266Deep OceanMEVLIINGRRYLINTSTPDGGDSICEWLLKQFKDEPVLDWDTPKLSDFTNKIR
Ga0208814_102654123300025276Deep OceanMEVLIIDGRRYLINTSTPDGGDSVCEWLLKQYDKTALVEFSEVTHADFTNKIRL
Ga0208814_106282413300025276Deep OceanILNGERYLINTQTHDGGDHQCDYLIKQFPDDVEIDWDEVKHSDFTNKIRL
Ga0208643_100011943300025645AqueousMDVPSEPSKNYCLMEVLVINGRRYLINTSTQDGGDSICEWLLKQFKDEPVLDWDQPKQSDFTNKIR
Ga0209374_1005058203300025705MarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEAKLSDFTNKIR
Ga0208941_100396073300027077MarineMEVMILNGRRYLINTQVTDGGDHQCEHLLKQFPDDVEIDWDEVKLSDFTNKIR
Ga0208797_100617123300027186EstuarineMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKVR
Ga0208674_101573443300027190EstuarineMEVLVINGRRYLINTSTQDGGDSICEWLLKQFKDEPVLDWDQPKPSDFTNKIR
Ga0208438_104822523300027196EstuarineMEVMILNGKRYLINTQTHNGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKVR
Ga0209482_106043013300027668MarinePSKLSKNYCLMEVLIINGRRYLINTSTPDGGDSICEWLLKQFKDEPVLDWDTPKLSDFTNKIR
Ga0209816_102002743300027704MarineMEVLIINGRRYLINTSTSDGGDSICEWLLKQFKDEPVLDWDTPKLSDFTNKIR
Ga0209121_1017580813300027742MarineMEVMILNGRRYLINTQVTDGGDYQCEHLLKQFPDDVEIDWDEVKLSDFTNKIR
Ga0209192_1012542413300027752MarineMEVLIINGRRYLINTSTPDGGDSICEWLLKQFRDEPELDWGTPKLSDFTNKIR
Ga0208671_1020111813300027757EstuarineRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKVR
Ga0209379_1012398443300027758Marine SedimentMEVMILNGRRYLINTQTHDGGDHQCEYLLKQFPPDVEVDWDEVKLSDFTNKIRL
Ga0209379_1025611813300027758Marine SedimentMEVMILNGKRYLINTQTHDGGDHQCEYLLKQFPDDVEIDWDEVKLSDFTNKIRL
Ga0209830_1001125053300027791MarineMEVLIINGSRYLINTSTLDGGDSICEWLLKQFRNEPELDWDTPKLSDFTNKIR
Ga0307488_1001893733300031519Sackhole BrineMEVMILNGRRYLINTQTHDGGDHQCEYLLKQFPPDVEVDWDEVKLSDFTNKIR
Ga0307488_1023240653300031519Sackhole BrineMEVMILNGRRYLINTQTHDGGDHQCEYLLKQFPSDVEVDWDEVKLSDFTNKIR
Ga0307488_1038811433300031519Sackhole BrineMEVLIINGRRYLINTSTPDGGDSICEWLLKQFKDEPELDWDTPKLSDFTNKIR
Ga0307488_1044688433300031519Sackhole BrineMEVLIINGRRYLINTSTPDGGDSVCEWLLKQFRNEPELDWDTPKLSDFTNKIR
Ga0307488_1083547023300031519Sackhole BrineMEVLIINSRRYLINTSTPDGGDSICEWLLKQFRDEPELDWDTPKLSDFTNKIR
Ga0307489_1045164623300031569Sackhole BrineMILNGKRYLINTQTHDGGDHQCEYLLKQFPSDVEVDWDEVKLSDFTNKIRL
Ga0302126_1003592873300031622MarineMEVMILNGRRYLINTQTHDGGDHQCEYLLKQFPLDVEVDWDEVKPSDFTNKIR
Ga0308014_110519133300031628MarineLMQVMILNGERYLINTQTHDGGDQQCDHLLKQFPDNVEIDWDEVKSSDFTSKIRL
Ga0302125_1017956923300031638MarineMEVMILNGRRYLINTQTHDGGDHQCEYLLKQFPLDVEVDWDEVKP
Ga0308011_1026761223300031688MarineMQIMILNGERYLINTQTHDGGDQQCDHLLKQFPDNVEIDWDEVKSSDFTSKIRL
Ga0302130_104040023300031700MarineMEVMILNGRRYLINTQTHDGGDHQCEYLLKQFPLDVEVDWDEVKPLDFTNKIR
Ga0308000_1017345123300031848MarineMILNGERYLINTQTHDGGDQQCDHLLKQFPDNVEIDWDEVKSSDFTSKIRL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.