NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101862

Metagenome / Metatranscriptome Family F101862

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101862
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 89 residues
Representative Sequence MCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Number of Associated Samples 92
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 7.84 %
% of genes near scaffold ends (potentially truncated) 62.75 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (94.118 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater
(20.588 % of family members)
Environment Ontology (ENVO) Unclassified
(55.882 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(47.059 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 56.03%    β-sheet: 0.00%    Coil/Unstructured: 43.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002835|B570J40625_101576620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila537Open in IMG/M
3300003216|JGI26079J46598_1068999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani678Open in IMG/M
3300004095|Ga0007829_10037613All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300004687|Ga0065174_1035791All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300004790|Ga0007758_10640341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes missouriensis880Open in IMG/M
3300004792|Ga0007761_10549569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes missouriensis672Open in IMG/M
3300004804|Ga0007796_10105116All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300006165|Ga0075443_10070809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1182Open in IMG/M
3300006415|Ga0099654_10387624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea901Open in IMG/M
3300006641|Ga0075471_10289361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani835Open in IMG/M
3300006803|Ga0075467_10227104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1024Open in IMG/M
3300006875|Ga0075473_10118392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1056Open in IMG/M
3300007725|Ga0102951_1172754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300008108|Ga0114341_10368707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium712Open in IMG/M
3300008113|Ga0114346_1189421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium834Open in IMG/M
3300008116|Ga0114350_1120662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium789Open in IMG/M
3300008119|Ga0114354_1246803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani576Open in IMG/M
3300009071|Ga0115566_10232865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1110Open in IMG/M
3300009265|Ga0103873_1020072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1091Open in IMG/M
3300009434|Ga0115562_1084392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1295Open in IMG/M
3300009434|Ga0115562_1226254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani660Open in IMG/M
3300009436|Ga0115008_10723587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani724Open in IMG/M
3300009436|Ga0115008_10785641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium697Open in IMG/M
3300009436|Ga0115008_11420903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300009442|Ga0115563_1115849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1121Open in IMG/M
3300009466|Ga0126448_1039427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1100Open in IMG/M
3300009497|Ga0115569_10221796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani862Open in IMG/M
3300009538|Ga0129287_10181279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani908Open in IMG/M
3300009606|Ga0115102_10834735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1198Open in IMG/M
3300012415|Ga0138263_1009345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani587Open in IMG/M
3300012782|Ga0138268_1156909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani713Open in IMG/M
3300018048|Ga0181606_10221977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1084Open in IMG/M
3300018420|Ga0181563_10232360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1107Open in IMG/M
3300018692|Ga0192944_1012475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1121Open in IMG/M
3300018874|Ga0192977_1023697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1182Open in IMG/M
3300018899|Ga0193090_1034235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1158Open in IMG/M
3300018899|Ga0193090_1048378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium987Open in IMG/M
3300018974|Ga0192873_10229450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium809Open in IMG/M
3300019021|Ga0192982_10070918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1100Open in IMG/M
3300019031|Ga0193516_10102510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani975Open in IMG/M
3300019032|Ga0192869_10126821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1025Open in IMG/M
3300019036|Ga0192945_10042070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1271Open in IMG/M
3300019036|Ga0192945_10079833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1004Open in IMG/M
3300019459|Ga0181562_10290019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium818Open in IMG/M
3300020172|Ga0211729_11446472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani662Open in IMG/M
3300020727|Ga0214246_1034104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani802Open in IMG/M
3300021336|Ga0210307_1035794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1295Open in IMG/M
3300021350|Ga0206692_1887186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani618Open in IMG/M
3300021962|Ga0222713_10270370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1097Open in IMG/M
3300023108|Ga0255784_10239167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium935Open in IMG/M
3300025389|Ga0208257_1025762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium885Open in IMG/M
3300025399|Ga0208107_1035691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium861Open in IMG/M
3300025418|Ga0208253_1040422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium825Open in IMG/M
3300025606|Ga0207954_1075068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium870Open in IMG/M
3300025640|Ga0209198_1166265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani595Open in IMG/M
3300025699|Ga0209715_1206524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani611Open in IMG/M
3300025732|Ga0208784_1144342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300025809|Ga0209199_1090556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1295Open in IMG/M
3300025887|Ga0208544_10145113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1024Open in IMG/M
3300026448|Ga0247594_1017406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1158Open in IMG/M
3300026448|Ga0247594_1049738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium720Open in IMG/M
3300026495|Ga0247571_1029561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1185Open in IMG/M
3300027720|Ga0209617_10119158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1054Open in IMG/M
3300027741|Ga0209085_1132025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1070Open in IMG/M
3300027833|Ga0209092_10684141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300027899|Ga0209668_10278957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1067Open in IMG/M
3300028134|Ga0256411_1076747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1144Open in IMG/M
3300028137|Ga0256412_1077895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1186Open in IMG/M
3300028137|Ga0256412_1086165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1131Open in IMG/M
3300028137|Ga0256412_1397544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300028595|Ga0272440_1099561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1042Open in IMG/M
3300030671|Ga0307403_10186870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1075Open in IMG/M
3300030699|Ga0307398_10702101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300030709|Ga0307400_10434173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium833Open in IMG/M
3300030725|Ga0308128_1009400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1128Open in IMG/M
3300030788|Ga0073964_11279662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani898Open in IMG/M
3300031569|Ga0307489_10308365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1026Open in IMG/M
3300031579|Ga0308134_1039355All Organisms → Viruses → Predicted Viral1084Open in IMG/M
3300031729|Ga0307391_10708323All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani574Open in IMG/M
3300031750|Ga0307389_10907981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
3300031752|Ga0307404_10475086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300032463|Ga0314684_10211792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1087Open in IMG/M
3300032481|Ga0314668_10132668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1217Open in IMG/M
3300032491|Ga0314675_10126647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1189Open in IMG/M
3300032491|Ga0314675_10238534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium901Open in IMG/M
3300032492|Ga0314679_10131548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1113Open in IMG/M
3300032517|Ga0314688_10132157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1194Open in IMG/M
3300032517|Ga0314688_10155974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1124Open in IMG/M
3300032519|Ga0314676_10310752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani926Open in IMG/M
3300032521|Ga0314680_10194291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1163Open in IMG/M
3300032615|Ga0314674_10149962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1154Open in IMG/M
3300032651|Ga0314685_10556748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani627Open in IMG/M
3300032707|Ga0314687_10689152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300032708|Ga0314669_10163778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1106Open in IMG/M
3300032713|Ga0314690_10128193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1169Open in IMG/M
3300032723|Ga0314703_10106661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1130Open in IMG/M
3300032724|Ga0314695_1080125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1138Open in IMG/M
3300032728|Ga0314696_10378388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium733Open in IMG/M
3300032733|Ga0314714_10161763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1205Open in IMG/M
3300032742|Ga0314710_10090114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1124Open in IMG/M
3300032745|Ga0314704_10173470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1146Open in IMG/M
3300032755|Ga0314709_10263521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1052Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater20.59%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine12.75%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine11.76%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine7.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater6.86%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater6.86%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.90%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.92%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.92%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.96%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.98%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater0.98%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.98%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.98%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.98%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.98%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.98%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.98%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.98%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment0.98%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.98%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.98%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.98%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.98%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300004095Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09EnvironmentalOpen in IMG/M
3300004687Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (version 2)EnvironmentalOpen in IMG/M
3300004790Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004792Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004804Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0MEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020727Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnionEnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300023108Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaGEnvironmentalOpen in IMG/M
3300025389Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes)EnvironmentalOpen in IMG/M
3300025399Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07 (SPAdes)EnvironmentalOpen in IMG/M
3300025418Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (SPAdes)EnvironmentalOpen in IMG/M
3300025606Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027741Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028595Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-MMB-Aug17EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030725Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B570J40625_10157662013300002835FreshwaterMCLPLGGEDEGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMIILGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAF*
JGI26079J46598_106899913300003216MarineMCLPFGGDDEGRDLMGNLVPPNQKARDLKTTLEIILGVHFFVAILKMVIIGIFSGISDLFSCLILWCGLCRFDYCNMLIYLILVIFDMF*
Ga0007829_1003761323300004095FreshwaterRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMVIIGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAF*
Ga0065174_103579113300004687FreshwaterMCLPLGGEDEGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMVIIGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAF*
Ga0007758_1064034113300004790Freshwater LakePLGGEDEGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMIILGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAF*
Ga0007761_1054956913300004792Freshwater LakeIMCLPLGGEDEGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMIILGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAF*
Ga0007796_1010511613300004804FreshwaterNMCLPLGGEDEGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMVIIGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAF*
Ga0075443_1007080913300006165MarineVIIFLYNYPLIKMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDIFSCLILWCGLCRFDYCNVLIYMILVVFDAF*
Ga0099654_1038762413300006415LakeLPLGGEDEGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMIILGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAFQLLIVLGFYF*
Ga0075471_1028936113300006641AqueousPKPQNPSQLAKFRKCYYNSKNMCLGLGGDDEQRDLMGNLVPPNQKARDLKSNLEIILGVHFFVAVVKMIVISIFSGVSDILSCLVLWCGLCRFDYCNMMIYIILVLFDTF*
Ga0075467_1022710433300006803AqueousMCLPLGGDDEGRDLMGNLVPPNQKARDLKSNLEIILGVHFFVAIVKMVIIGILSGISDLLSCLVLWCGLCRFDYCNMMIYLILTLFDGFQLLVVLGYYF*
Ga0075473_1011839223300006875AqueousMCLGLGGDDEQRDLMGNLVPPNQKARDLKSNLEIILGVHFFVAVVKMIVISIFSGVSDILSCLVLWCGLCRFDYCNMMIYIILVLFDTF*
Ga0102951_117275413300007725WaterMCLGLGDDDGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAILKMVIIGILSGISDLLSCLILWCGLCRFDYCNMIIYVILVLFDAFQLVIILGFYF*
Ga0114341_1036870723300008108Freshwater, PlanktonGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMIILGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAF*
Ga0114346_118942133300008113Freshwater, PlanktonGEDEGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMIILGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAF*
Ga0114350_112066223300008116Freshwater, PlanktonEDEGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMIILGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAF*
Ga0114354_124680313300008119Freshwater, PlanktonLGGEDEGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMIILGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAF*
Ga0115566_1023286533300009071Pelagic MarineMCLGLGDDDGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAILKMVIIGLLSGITDLLSCLILWCGLCRFDYCNMIIYVILVLFDAF*
Ga0103873_102007213300009265Surface Ocean WaterDDEGRDLMGNLVPPNQKARDLKTTLEIILGVHFFVAILKMVIIGIFSGISDLFSCLILWCGLCRFDYCNMLIYLILVIFDMF*
Ga0115562_108439223300009434Pelagic MarineMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF*
Ga0115562_122625413300009434Pelagic MarineMGNLVPPTQKARDLKSTLEIILGVHFFVAIVKMVIMGITSGLSDILSCLILWCGLCKFDYCNLLMYCILVLFDFFQLIIVAGFYF*
Ga0115008_1072358723300009436MarineVTLSPNNYIYLNNIIKIKMCLALGDDDEGRDLMGNLVPPNQKARDLKSALQIILGTHAFVAIIKMIFIGIFSGIGDIFSCLVLWCGIYRYDYCQMMTYIILTLFDLF*
Ga0115008_1078564123300009436MarineMCLPFGEDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAVLKMVIIGIFSGISDIFSCLILWCGLCRFDYCNVLIYMIMVIFDGF*
Ga0115008_1142090313300009436MarineMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVLIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF*
Ga0115563_111584913300009442Pelagic MarineLLVIIFLHNYPLIKMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF*
Ga0126448_103942713300009466Meromictic PondMCLGLGDDDGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAILKMVIIGILSGISDLLSCLILWCGLCRFDYCNMIIYVILVLFDAF*
Ga0115569_1022179623300009497Pelagic MarineMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVIIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMVLVIFDAF*
Ga0129287_1018127923300009538Beach Aquifer PorewaterFKKIIHIYLIIYCINKNMCIPFGGDDEGRDLMGNLVPPNQKARDLKSNLEIILGVHFFVAVLKMIVIGIMSGLSDILSCCVLWCGLCRFDYCNMIIYVILVLFDCFQLLIVLGYYVQTS*
Ga0115102_1083473513300009606MarineMCLGLGAEDDGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAIVKMVVLGIGAGLSDILSCLILWCGLCKFDYCNCLIYVILVCFDLF*
Ga0138263_100934513300012415Polar MarineCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDIFSCLILWCGLCRFDYCNVLIYMILVVFDAF*
Ga0138268_115690913300012782Polar MarineLPFGEDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVIIGIFSGISDLFSCLILWCGLCFDYCNVLIYMILVIFDAF*
Ga0181606_1022197723300018048Salt MarshMCLGLGDDDGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAILKMVIIGILSGISDLLSCLILWCGLCRFDYCNMIIYVILVLFDAFQLVIILGFYFQTE
Ga0181563_1023236033300018420Salt MarshMCLGLGDDDGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAILKMVIIGLLSGITDLLSCLILWCGLCRFDYCNMIIYVILVLFDAF
Ga0192944_101247523300018692MarineMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMVVIGIFSGLSDIFSCIILWCGLCRFDYCNMLIYIVLTLFDAFQLLVILGYYF
Ga0192977_102369723300018874MarineKMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDIFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0193090_103423513300018899MarineDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0193090_104837813300018899MarineMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMIVIGIFSGLSDIFSCIILWCGLCRFDYCNMLIYIVLTLFDAFQLLVILGYYF
Ga0192873_1022945013300018974MarineTWGYQRKMCFGLGEDDNRDLSGNLVSITSKARDLKSSLEIIVGVHFFVAILKMFLIGFFSGISDIISAIILWCALCRFDYCNMLIYVILVLFDVF
Ga0192982_1007091833300019021MarineMGIIFLYNYPLIKMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0193516_1010251013300019031MarineTWAIIIQLKMCLALGDDDEGRDLMGNLVPPNEKARSLKTALQIILGIHAFVAIVKMIFIGIFSGIGDIFACLILWCGLCRFDYCAMITYIILVLFNLL
Ga0192869_1012682133300019032MarineMGNLVPPNQKARSLKTSLEIILGAHFFVAIAKMVLLGIFSGLTDLFACIILWCGLCRFDYCNMFIYLVLVLFDIF
Ga0192945_1004207013300019036MarineMGIIFLINYPLIKMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0192945_1007983313300019036MarineMGNLVPPNQKARDLKSILEIILGVHFFVAIVKMIVIGIFSGLSDILSCIILWCGLCKFDYCNMLIYIILTCFDAFQLLVILGYYF
Ga0181562_1029001933300019459Salt MarshMCLGLGDDDGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAILKMVIIGLLSGITDLLSCLILWCGLCRFDYCNMLIYLILVIFDMF
Ga0211729_1144647223300020172FreshwaterLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMIILGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAF
Ga0214246_103410413300020727FreshwaterMCLPLGGEDEGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMVIIGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAF
Ga0210307_103579413300021336EstuarineMCLPFGGDDEGRDLMGNLVPPNQKARDLKTTLEIILGVHFFVAILKMVIIGIFSGISDLFSCLILWCGLCRFDYCNMLIYLILVIFDMF
Ga0206692_188718613300021350SeawaterIKMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0222713_1027037013300021962Estuarine WaterMCLGLGGDDEQRDLMGNLVPPNQKARDLKSNLEIILGVHFFVAIVKMVIIGVFSGLSDILSCLVLWCGLCRFDYCNMMIYVILVLFDCFQLLIVLGYYFQT
Ga0255784_1023916713300023108Salt MarshDDEGRDLMGNLVPPNQKARDLKTTLEIILGVHFFVAILKMVIIGIFSGISDLFSCLILWCGLCRFDYCNMLIYLILVIFDMF
Ga0208257_102576213300025389FreshwaterLGGEDEGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMVIIGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAF
Ga0208107_103569113300025399FreshwaterDLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMVIIGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAF
Ga0208253_104042213300025418FreshwaterCLPLGGEDEGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMVIIGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAF
Ga0207954_107506813300025606FreshwaterNMCLPLGGEDEGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMVIIGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAF
Ga0209198_116626513300025640Pelagic MarineMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0209715_120652413300025699Pelagic MarineMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVIIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMVLVIFDAF
Ga0208784_114434223300025732AqueousMCLGLGGDDEQRDLMGNLVPPNQKARDLKSNLEIILGVHFFVAVVKMIVISIFSGVSDILSCLVLWCGLCRFDYCNMMIYIILVLFDTF
Ga0209199_109055613300025809Pelagic MarineMLLVIIFLYNYPLIKMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0208544_1014511313300025887AqueousMCLPLGGDDEGRDLMGNLVPPNQKARDLKSNLEIILGVHFFVAIVKMVIIGILSGISDLLSCLVLWCGLCRFDYCNMMIYLILTLFDGFQLLVVLGYYF
Ga0247594_101740613300026448SeawaterKMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0247594_104973823300026448SeawaterMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMVVIGIFSGLSDIFSCIILWCGLCRFDYCNMLIYIVLTLFDAF
Ga0247571_102956113300026495SeawaterIDKNVSPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0209617_1011915813300027720Freshwater And SedimentPKTPKPLKHDYQYNFIIFKIIMCLPLGGEDEGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMIILGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAF
Ga0209085_113202513300027741Freshwater LakeMCLPLGGEDEGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMIILGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAF
Ga0209092_1068414113300027833MarineMCLALGDDDEGRDLMGNLVPPNQKARDLKSALQIILGTHAFVAIIKMIFIGIFSGIGDIFSCLVLWCGIYRYDYCQMMTYIILTLFDLF
Ga0209668_1027895713300027899Freshwater Lake SedimentMCLPLGGEDEGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAIVKMIILGIFSGISDLFSCIILWCGLCRFDYCNLLIYIILTLFDAFQLLIVLGFYF
Ga0256411_107674733300028134SeawaterMGNLVPPNQKARDLKSILEIILGIHFFVAIVKMIVIGLFAGISDIFSCAVLWCGLCRFDYCNMLIYIILVLFDCF
Ga0256412_107789513300028137SeawaterLIKMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0256412_108616513300028137SeawaterIKMCLPFGEDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVIIGIFSGISDIFSCLILWCGLCKFDYCNVLIYMIMVIFDAFQLIVILGFYF
Ga0256412_139754413300028137SeawaterKMCLPFGGDDEGRDLMGNLVPPNQKARDLKTSLEIILGVHFFVAILKMVIIGILSGISDLFSCLILWCGLCRFDYCNMLIYLILVIFDSF
Ga0272440_109956133300028595Marine SedimentMGGDDEGRDLMGNLVPPNQKARDLKSTLEIILGVHFFVAVVKMVVIGLFSGISDLFSCLILWCGLCRFDYCNVLIYMILVLFDTF
Ga0307403_1018687033300030671MarineLPFGEDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVIIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVIFDAF
Ga0307398_1070210113300030699MarineNMCIPFGGDDEGRDLMGNLVPPNQKARDLKSNLEIILGVHFFVAIVKMVIIGVMSGISDILSCLILWCGLCRFDYCNMIIYVILVLFDAF
Ga0307400_1043417313300030709MarineMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDIFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0308128_100940013300030725MarineFGEDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAVLKMVIIGIFSGISDIFSCLILWCGLCKFDYCNVLIYMIMVIFDGF
Ga0073964_1127966223300030788MarinePLGGDDEQRDFMGNLVPPNQKARDLKSSLEIILGVHFFVAIVKMVIIGIFSGISDIFSCVILWCGLCRFDYCNMFIYLVFVLFDVF
Ga0307489_1030836533300031569Sackhole BrineMCLPFGGDDEGRDLMGNLVPPNQKARDLKSNLEIILGVHFFVAIVKMVIIGIMSGLSDLLSCLVLWCGLCRFDYCNMIIYVILVIFDAF
Ga0308134_103935513300031579MarineLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0307391_1070832323300031729MarineCIPFGGDDEGRDLMGNLVPPNQKARDLKSNLEIILGVHFFVAIVKMVIIGVMSGISDILSCLILWCGLCRFDYCNMIIYVILVLFDAF
Ga0307389_1090798113300031750MarinePFGEDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVIIGIFSGISDIFSCLILWCGLCKFDYCNVLIYMIMVIFDAFQLMVILGFYF
Ga0307404_1047508613300031752MarineFGEDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVIIGIFSGISDLFSCLILWCGRCRFDYCNVLIYMILVIFDAF
Ga0314684_1021179223300032463SeawaterSFIIKMCLPFGEDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAVLKMVIIGIFSGISDIFSCLILWCGLCRFDYCNVLIYMIMVIFDGF
Ga0314668_1013266823300032481SeawaterMCLPFGEDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAVLKMVIIGIFSGISDIFSCLILWCGLCRFDYCNVLIYMIMVIFDGF
Ga0314675_1012664723300032491SeawaterYPLIKMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVLIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0314675_1023853413300032491SeawaterFIIKMCLPFGEDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAVLKMVIIGIFSGISDIFSCLILWCGLCRFDYCNVLIYMIMVIFDGF
Ga0314679_1013154813300032492SeawaterIIKMCLPFGEDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAVLKMVIIGIFSGISDIFSCLILWCGLCRFDYCNVLIYMIMVIFDGF
Ga0314688_1013215713300032517SeawaterIKMCLPFGEDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAVLKMVIIGIFSGISDIFSCLILWCGLCRFDYCNVLIYMIMVIFDGF
Ga0314688_1015597433300032517SeawaterCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVLIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0314676_1031075233300032519SeawaterLIKMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVLIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0314680_1019429123300032521SeawaterIKMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVLIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0314674_1014996213300032615SeawaterLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVLIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0314685_1055674823300032651SeawaterNYPLIKMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVLIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0314687_1068915223300032707SeawaterKMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMIRVVLMLSNYLSF
Ga0314669_1016377833300032708SeawaterDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVLIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0314690_1012819313300032713SeawaterEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVLIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0314703_1010666113300032723SeawaterMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVLIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0314695_108012513300032724SeawaterGEDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAVLKMVIIGIFSGISDIFSCLILWCGLCRFDYCNVLIYMIMVIFDGF
Ga0314696_1037838823300032728SeawaterKMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVLIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0314714_1016176313300032733SeawaterPLIKMCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0314710_1009011433300032742SeawaterCLPFGDDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAILKMVVIGIFSGISDLFSCLILWCGLCRFDYCNVLIYMILVVFDAF
Ga0314704_1017347023300032745SeawaterLPFGEDEGRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAVLKMVIIGIFSGISDIFSCLILWCGLCRFDYCNVLIYMIMVIFDGF
Ga0314709_1026352113300032755SeawaterRDLMGNLVPPNQKARDLKSTLEIILGIHFFVAVLKMVIIGIFSGISDIFSCLILWCGLCRFDYCNVLIYMIMVIFDGF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.