Basic Information | |
---|---|
Family ID | F101819 |
Family Type | Metagenome |
Number of Sequences | 102 |
Average Sequence Length | 42 residues |
Representative Sequence | VAGFVDVLLRGLALCGQAIAVGGVCFALLLLRPASSEDPA |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 77.00 % |
% of genes near scaffold ends (potentially truncated) | 97.06 % |
% of genes from short scaffolds (< 2000 bps) | 84.31 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.078 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.667 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.451 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.078 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF01066 | CDP-OH_P_transf | 53.92 |
PF02894 | GFO_IDH_MocA_C | 3.92 |
PF00202 | Aminotran_3 | 2.94 |
PF01568 | Molydop_binding | 0.98 |
PF07676 | PD40 | 0.98 |
PF05425 | CopD | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 53.92 |
COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 53.92 |
COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 53.92 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 3.92 |
COG1276 | Putative copper export protein | Inorganic ion transport and metabolism [P] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.08 % |
Unclassified | root | N/A | 3.92 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002560|JGI25383J37093_10059525 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300004268|Ga0066398_10163414 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300005174|Ga0066680_10896630 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 526 | Open in IMG/M |
3300005179|Ga0066684_10628581 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 722 | Open in IMG/M |
3300005332|Ga0066388_103853899 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 765 | Open in IMG/M |
3300005445|Ga0070708_100089967 | All Organisms → cellular organisms → Bacteria | 2793 | Open in IMG/M |
3300005447|Ga0066689_10654199 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300005451|Ga0066681_10379404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 869 | Open in IMG/M |
3300005518|Ga0070699_100089885 | All Organisms → cellular organisms → Bacteria | 2684 | Open in IMG/M |
3300005558|Ga0066698_10710549 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300005719|Ga0068861_101978142 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300005764|Ga0066903_100228593 | All Organisms → cellular organisms → Bacteria | 2833 | Open in IMG/M |
3300005843|Ga0068860_102791729 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
3300006031|Ga0066651_10554529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
3300006032|Ga0066696_10375541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 927 | Open in IMG/M |
3300006169|Ga0082029_1709659 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 657 | Open in IMG/M |
3300006791|Ga0066653_10030495 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2119 | Open in IMG/M |
3300006871|Ga0075434_100267291 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
3300006904|Ga0075424_100294779 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
3300006969|Ga0075419_10449155 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 889 | Open in IMG/M |
3300007004|Ga0079218_10433999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1133 | Open in IMG/M |
3300007076|Ga0075435_100215142 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1631 | Open in IMG/M |
3300007255|Ga0099791_10299370 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 767 | Open in IMG/M |
3300009012|Ga0066710_103527591 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 591 | Open in IMG/M |
3300009090|Ga0099827_11206088 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 658 | Open in IMG/M |
3300009162|Ga0075423_10849032 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 967 | Open in IMG/M |
3300009792|Ga0126374_11901109 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 500 | Open in IMG/M |
3300010048|Ga0126373_12661233 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300010304|Ga0134088_10014545 | All Organisms → cellular organisms → Bacteria | 3410 | Open in IMG/M |
3300010304|Ga0134088_10625155 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 537 | Open in IMG/M |
3300010320|Ga0134109_10044072 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1460 | Open in IMG/M |
3300010333|Ga0134080_10012704 | All Organisms → cellular organisms → Bacteria | 3025 | Open in IMG/M |
3300010335|Ga0134063_10197374 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 946 | Open in IMG/M |
3300010360|Ga0126372_10645659 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1024 | Open in IMG/M |
3300010360|Ga0126372_11509145 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 708 | Open in IMG/M |
3300010362|Ga0126377_12730995 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 569 | Open in IMG/M |
3300010398|Ga0126383_11286912 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 821 | Open in IMG/M |
3300010400|Ga0134122_10904832 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 854 | Open in IMG/M |
3300011270|Ga0137391_11495697 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 520 | Open in IMG/M |
3300011436|Ga0137458_1275787 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 513 | Open in IMG/M |
3300012152|Ga0137347_1096907 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 528 | Open in IMG/M |
3300012199|Ga0137383_11213757 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 541 | Open in IMG/M |
3300012205|Ga0137362_11679712 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 522 | Open in IMG/M |
3300012353|Ga0137367_10243451 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1294 | Open in IMG/M |
3300012353|Ga0137367_10478643 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300012357|Ga0137384_11431963 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 539 | Open in IMG/M |
3300012362|Ga0137361_11088648 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 720 | Open in IMG/M |
3300012685|Ga0137397_10109881 | All Organisms → cellular organisms → Bacteria | 2026 | Open in IMG/M |
3300012918|Ga0137396_11028335 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
3300012923|Ga0137359_10717730 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 870 | Open in IMG/M |
3300012930|Ga0137407_10914753 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 830 | Open in IMG/M |
3300012944|Ga0137410_11216191 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 649 | Open in IMG/M |
3300012948|Ga0126375_10415655 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 977 | Open in IMG/M |
3300012971|Ga0126369_13170220 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
3300014884|Ga0180104_1003877 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → Candidatus Methylomirabilis → Candidatus Methylomirabilis oxyfera | 3197 | Open in IMG/M |
3300014969|Ga0157376_12768530 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 530 | Open in IMG/M |
3300015054|Ga0137420_1005506 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → Candidatus Methylomirabilis → Candidatus Methylomirabilis oxyfera | 2311 | Open in IMG/M |
3300015054|Ga0137420_1153142 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 635 | Open in IMG/M |
3300015372|Ga0132256_101310944 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 837 | Open in IMG/M |
3300017659|Ga0134083_10247815 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 745 | Open in IMG/M |
3300017974|Ga0187777_11369421 | Not Available | 521 | Open in IMG/M |
3300018058|Ga0187766_10112955 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → Candidatus Methylomirabilis → Candidatus Methylomirabilis oxyfera | 1658 | Open in IMG/M |
3300020004|Ga0193755_1224743 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 520 | Open in IMG/M |
3300020170|Ga0179594_10094357 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1069 | Open in IMG/M |
3300025569|Ga0210073_1069421 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300025972|Ga0207668_11678573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 574 | Open in IMG/M |
3300026296|Ga0209235_1251878 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 546 | Open in IMG/M |
3300026297|Ga0209237_1014848 | All Organisms → cellular organisms → Bacteria | 4577 | Open in IMG/M |
3300026309|Ga0209055_1031762 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2407 | Open in IMG/M |
3300026315|Ga0209686_1066018 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1294 | Open in IMG/M |
3300026324|Ga0209470_1091921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Tistlia → Tistlia consotensis | 1373 | Open in IMG/M |
3300026324|Ga0209470_1381412 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
3300026327|Ga0209266_1032343 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2756 | Open in IMG/M |
3300026328|Ga0209802_1282751 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 553 | Open in IMG/M |
3300026359|Ga0257163_1060602 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 606 | Open in IMG/M |
3300026376|Ga0257167_1005038 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
3300026538|Ga0209056_10170259 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1636 | Open in IMG/M |
3300027490|Ga0209899_1013330 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
3300027874|Ga0209465_10609873 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 540 | Open in IMG/M |
3300027880|Ga0209481_10245917 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 900 | Open in IMG/M |
3300028381|Ga0268264_10832298 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 924 | Open in IMG/M |
3300031198|Ga0307500_10275687 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 527 | Open in IMG/M |
3300031679|Ga0318561_10777299 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 526 | Open in IMG/M |
3300031720|Ga0307469_10372765 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1207 | Open in IMG/M |
3300031740|Ga0307468_102013281 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 553 | Open in IMG/M |
3300031820|Ga0307473_10836451 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 659 | Open in IMG/M |
3300031820|Ga0307473_10962740 | Not Available | 621 | Open in IMG/M |
3300031858|Ga0310892_10564335 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 766 | Open in IMG/M |
3300031858|Ga0310892_11177890 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 545 | Open in IMG/M |
3300031910|Ga0306923_10579410 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1262 | Open in IMG/M |
3300032054|Ga0318570_10151739 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1037 | Open in IMG/M |
3300032067|Ga0318524_10015992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3272 | Open in IMG/M |
3300032067|Ga0318524_10537848 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 614 | Open in IMG/M |
3300032075|Ga0310890_10200156 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1369 | Open in IMG/M |
3300032174|Ga0307470_11765628 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 523 | Open in IMG/M |
3300032180|Ga0307471_100497487 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1366 | Open in IMG/M |
3300032205|Ga0307472_100782138 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300033004|Ga0335084_10150254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 2423 | Open in IMG/M |
3300034114|Ga0364938_033751 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 839 | Open in IMG/M |
3300034164|Ga0364940_0018641 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.71% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.84% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.86% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.88% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.88% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.92% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.96% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.98% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
3300012152 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300025569 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25383J37093_100595251 | 3300002560 | Grasslands Soil | VAGFVDVLLRGLALCGQAVAIGGVFFAALLLRPASREDPAAR |
Ga0066398_101634141 | 3300004268 | Tropical Forest Soil | VAGFVDVLLRGLALCGQSIAVGGVCFALLLLRPGSSEAARQ |
Ga0066680_108966301 | 3300005174 | Soil | VAGFVDVLLRGLALCGQAIAIGGVVFAALLLRPAVRQDAAVRPRL |
Ga0066684_106285812 | 3300005179 | Soil | VTGFVDVLLRGLALCGQAVAVGGVVFGWALLRPALARRPV |
Ga0066388_1038538992 | 3300005332 | Tropical Forest Soil | VAGFVDVLLRGLALCGQSIAVGGVCFALLLLRAASSEDAAARRR |
Ga0070708_1000899674 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VAGFADVLLRGLALCGQAAAIGGVLFALVVLKPALRPRPE |
Ga0066689_106541991 | 3300005447 | Soil | VAGFADVLLRGLALCGQAAAIGGVLFALVVLKPALRPRPELS |
Ga0066681_103794042 | 3300005451 | Soil | VAGFLDVLLRGLALCGQAIAMGGIFFAVLVLRPATREDPAS |
Ga0070699_1000898851 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VAEFVDVLLRGLALCGQAVAVGGVVFAALLLRPRAREAPAA |
Ga0066698_107105492 | 3300005558 | Soil | VAGFVDVLLRGLALCGQAIAVGGVCFALLLLRPASSEDPA |
Ga0066699_111873892 | 3300005561 | Soil | VAAFADVLLRGLALSGQVVAIGGVLFALLVLGPSRS |
Ga0068861_1019781422 | 3300005719 | Switchgrass Rhizosphere | VAGFVDVLLRGLALCGQGVAIGGVFFALLLLRPSLSDGAPARRRLTKSLVLT |
Ga0066903_1002285934 | 3300005764 | Tropical Forest Soil | VAGFLDVLLRGLALCGQSIAVGGVCFALLLLRAASSEDAAARRRLVRSLVL |
Ga0068860_1027917291 | 3300005843 | Switchgrass Rhizosphere | VAGFVDVLLRGLALCGQSIAVGGVCFALLLLRAASSEDAGARRRLVGSLMLTAAGALA |
Ga0066651_105545291 | 3300006031 | Soil | VAGFLDVLLRGLALCGQAIAMGGIFFAVLVLRPATR |
Ga0066696_103755411 | 3300006032 | Soil | VAGFLDVLLRGLALCGQAIAMGGIFFAVLVLRPATREDP |
Ga0082029_17096591 | 3300006169 | Termite Nest | MAAFLDVILRGLALAGQAVAIGGVLFALLVVRENTRRV |
Ga0066653_100304953 | 3300006791 | Soil | VAGLVDVVLRGLALCGQAVAVGGVLFALLVLRPAVRAR |
Ga0075434_1002672913 | 3300006871 | Populus Rhizosphere | VAGFVDVLLRGLALCGQAVAIGGVLFAILLLRPALA |
Ga0075424_1002947793 | 3300006904 | Populus Rhizosphere | VAGFVDVLLRGLALCGQAVAIGGVLFAILLLRPAL |
Ga0075419_104491552 | 3300006969 | Populus Rhizosphere | VAGFVDVLLRGLALCGQSIAVGGVCFALLLLRAASSEDAAARR |
Ga0079218_104339991 | 3300007004 | Agricultural Soil | VAGFVDVLLRGLILAGQAMAVGGIVFLLWVIRPAS |
Ga0075435_1002151421 | 3300007076 | Populus Rhizosphere | VAGFVDVLLRGLALCGQSIAVGGVCFALLLLRAASSEDAAARRRLVR |
Ga0099791_102993702 | 3300007255 | Vadose Zone Soil | VAGFVDVLLRGLALCGQAVAVGGVLFAVLLLRPEVAAHPALAPRLT |
Ga0066710_1035275911 | 3300009012 | Grasslands Soil | VAGFLDVILRGLALCGQAAAIGGVCFALLVLRPAARQRPEL |
Ga0099827_112060882 | 3300009090 | Vadose Zone Soil | MAGFLDVILRGLALCGQAAAIGGVCFALLVLRPAVRQRPE |
Ga0075423_108490321 | 3300009162 | Populus Rhizosphere | MAAFVDVLLRGLALTGQAIAVGGVVFALVVLRSAEEATARQPWRRL |
Ga0126374_119011091 | 3300009792 | Tropical Forest Soil | LIGFLDILLRGLALCGQGLAVGGVFFGLLILRPAARA |
Ga0126373_126612331 | 3300010048 | Tropical Forest Soil | VIGFLDVILRGLALCGQSMAMGGVLFALCVLRAATEDEAA |
Ga0134088_100145454 | 3300010304 | Grasslands Soil | VAGFVDVLLRGVALCGQAMAIGGVLFALLVLRPAVRAR |
Ga0134088_106251552 | 3300010304 | Grasslands Soil | VAGFLDVILRGLALCGQAAAIGGVCFALLVLRPAARQRPELTGL |
Ga0134109_100440723 | 3300010320 | Grasslands Soil | VAGFVDVLLRGLALCGQAVAVGGVLFAVLLLRPEVAARPT |
Ga0134080_100127044 | 3300010333 | Grasslands Soil | VAGFVDVLLRGVALCGQAMAIGGVLFALLVLRPAVRA |
Ga0134063_101973742 | 3300010335 | Grasslands Soil | VAGFLDVILRGLALCGQAAAIGGVCFALLVLRPAARQRPELAGLV |
Ga0126372_106456592 | 3300010360 | Tropical Forest Soil | VAGFIDVLLRGLALCGQAAAIGGVLFALVVLRPALR |
Ga0126372_115091451 | 3300010360 | Tropical Forest Soil | MAAFVDVLLRGMALSGQAIAIGGVVFALIVLGPEAGSARSAW |
Ga0126377_127309951 | 3300010362 | Tropical Forest Soil | VAGFVDVLLRGLALCGQAVAVGGVLFALLLLRPALGDGEPAR |
Ga0126383_112869122 | 3300010398 | Tropical Forest Soil | VAGFVDVLLRGLALCGQSIAVGGVCFALLLLRAASSEDA |
Ga0134122_109048321 | 3300010400 | Terrestrial Soil | VAGFVDVLLRGLALCGQSIAVGGVCFALLLLRAASSE |
Ga0137391_114956972 | 3300011270 | Vadose Zone Soil | VAGFVDVLLRGLALCGQAVAVGGVVFGLWLLLPALAARP |
Ga0137458_12757871 | 3300011436 | Soil | VAGFVDVLLRGLALCGQAAAIGGVLFALVVLKPAARR |
Ga0137347_10969071 | 3300012152 | Soil | VAGFLDVLLRGLALSGQAAAIGGVLFGLIVLRPVVRRRPE |
Ga0137383_112137571 | 3300012199 | Vadose Zone Soil | VAGFVDVLLRGLALCGQAVAIGGVLFAMLLLRPTLR |
Ga0137362_116797121 | 3300012205 | Vadose Zone Soil | VAGFLDVLLRGLALCGQAIAMGGIFFAVLVLRPAIREDPASGARER |
Ga0137367_102434511 | 3300012353 | Vadose Zone Soil | VAGFVDVLLRGLALCGQAVAVGGVFFAALLLGPAAR |
Ga0137367_104786431 | 3300012353 | Vadose Zone Soil | LTAVAGFLDVLLRGLALCGQAVAMGGVFFAVLVLRPVSREEPAW |
Ga0137384_114319632 | 3300012357 | Vadose Zone Soil | VAGFLDVLLRGLALCGQAIAMGGIFFAVLVLRPASREDPASGARERR |
Ga0137361_110886481 | 3300012362 | Vadose Zone Soil | VAGFVDVLLRGVALCGQAMAIGGVLFALLVLRPAVRARPALASP |
Ga0137397_101098813 | 3300012685 | Vadose Zone Soil | VAGFADVLLRGLALCGQAAAIGGVLFALVVLKPALRP |
Ga0137396_110283351 | 3300012918 | Vadose Zone Soil | VRGSAPDTTVAGFVDVLLRGFALCGQAVAVGGVIFAALLLRPEVVARPA |
Ga0137359_107177302 | 3300012923 | Vadose Zone Soil | VAGFLDVLLRGLALCGQAIAMGGIFFAVLVLRPAIREDPALAARERR |
Ga0137407_109147532 | 3300012930 | Vadose Zone Soil | VAGFVDVLLRGLALCGQAVAVGGVLFAVLLLRPEAAARPALA |
Ga0137410_112161911 | 3300012944 | Vadose Zone Soil | VAGFVDVLLRGLALCGQAIAVGGVLFAVLLLRPEVAA |
Ga0126375_104156551 | 3300012948 | Tropical Forest Soil | VAGFVDVLLRGLALCGQSIAVGGVCFALLLLRPGSSEETARQRL |
Ga0126369_131702202 | 3300012971 | Tropical Forest Soil | VAGFVDVLLRGLALCGQSIAVGGVCFALLLLRAASSEDAAARRRLVRSLVL |
Ga0180104_10038774 | 3300014884 | Soil | VAGFVDVLLRGLALCGQAAAIGGVLFALIVLRPALRQRPELAPL |
Ga0157376_127685302 | 3300014969 | Miscanthus Rhizosphere | VAGFVDVLLRGLALCGQAVAIGGVLFALLLLRPALGEGGAARARLVR |
Ga0137420_10055063 | 3300015054 | Vadose Zone Soil | VAGFVDVLLRGLALCGQAIALGGVVFALLLLRPVLPESGPA |
Ga0137420_11531422 | 3300015054 | Vadose Zone Soil | VAGFVDVLLRGLALCGQAIALGGVVFALLLLRPVLPESGPARSRLTRS |
Ga0132256_1013109441 | 3300015372 | Arabidopsis Rhizosphere | VAGFVDVLLRGLALCGQGVAIGGVFFALLLLRPTLADGAPAHRR |
Ga0134112_103544011 | 3300017656 | Grasslands Soil | VTGFIDVLLRGMALCGQAAAIGGVLFALIVLKPSLRDRPELSP |
Ga0134083_102478151 | 3300017659 | Grasslands Soil | VAGFVDVLLRGLALCGQAIAVGGVCFALLLRRPASSEDPAARR |
Ga0187777_113694211 | 3300017974 | Tropical Peatland | VTGFLDVVLRGLALCGQAMAMGGVLFALWVLRAATEDRPPMGPRI |
Ga0187766_101129553 | 3300018058 | Tropical Peatland | VAGFADVLLRGLALCGQAAAIGGVLFALFVLRPALRQRP |
Ga0193755_12247432 | 3300020004 | Soil | VAGFADVLLRGLALCGQAAAIGGVLFALVVLKPALRPR |
Ga0179594_100943572 | 3300020170 | Vadose Zone Soil | VAGFVDVLLRGLALCGQAIAVGGVCFALLLLRRPAS |
Ga0210073_10694211 | 3300025569 | Natural And Restored Wetlands | MTGFLDVLLRGVALSGQAIVVGGLFFIVLVLRPVAREDPAWAGR |
Ga0207668_116785731 | 3300025972 | Switchgrass Rhizosphere | VAGFVDVLLRGLALCGQAVAIGGVLFALLLLRPNLG |
Ga0209235_12518781 | 3300026296 | Grasslands Soil | VAGFVDVLLRGLALCGQAVAIGGVFFAALLLRPASREDPAARSRLARSLALTAGGA |
Ga0209237_10148482 | 3300026297 | Grasslands Soil | VAGFVDVLLRGLALCGQAIAIGGVVFAALLLRPAVRQDAAVRAW |
Ga0209055_10317621 | 3300026309 | Soil | VAGFVDVLLRGLALCGQAVVIGGVLFAMLLLRPTLPEGGPARARLVRSLAFTAIGAAVV |
Ga0209686_10660182 | 3300026315 | Soil | VAGFVDVLLRGLALCGQAVAIGGVLFAMLLLRPTLREGGPAC |
Ga0209470_10919211 | 3300026324 | Soil | VAGFVDVLLRGLALCGQAVAIGGVLFALLLLRPALPEGGPARSRLARSLALT |
Ga0209470_13814121 | 3300026324 | Soil | VAEFVDVLLRGLALCGQAIAVGGVFFVALLLRPASREDPAARSRL |
Ga0209266_10323434 | 3300026327 | Soil | VAGFVDVLLRGLALCGQALAVGGVCFALLLLLRPASS |
Ga0209802_12827511 | 3300026328 | Soil | VAGFVDVLLRGLALCGQAIAIGGVVFAALLLRPAVRQDAAVRPRLVKSLALTA |
Ga0257163_10606021 | 3300026359 | Soil | VAGFLDVILRGLALCGQAAAIGGVCFAILVLRPAVRQRPEL |
Ga0257167_10050381 | 3300026376 | Soil | VAGFVDVLLRGLALCGQAVAIGGVFFAALLLRPASRE |
Ga0209056_101702593 | 3300026538 | Soil | VAGFLDVLLRGLALCGQAIAMGGIFFAVLVLRPATREDPALAAR |
Ga0209899_10133301 | 3300027490 | Groundwater Sand | VTGFVDVLLRGLALCGQAVAVGGVFFAVLLLRPASREDPAARSRLARSLAL |
Ga0209465_106098732 | 3300027874 | Tropical Forest Soil | VAGFVDVLLRGFALCGQSIAVGGVCFALLLLRPGSGEAAARQRLVRSLVLTAAGAIV |
Ga0209481_102459171 | 3300027880 | Populus Rhizosphere | VAGFVDVLLRGLALCGQSIAVGGVCFALLLLRAASSEDAAARRRL |
Ga0268264_108322981 | 3300028381 | Switchgrass Rhizosphere | VAGFVDVLLRGLALCGQSIAVGGVCFALLLLRAASSEDAAARRRLVRSLM |
Ga0307500_102756871 | 3300031198 | Soil | VAGFVDVLLRGLALCGQAIAIGGVLFALLLLRPTLGEGGAA |
Ga0318561_107772992 | 3300031679 | Soil | VAGFVDVLLRGLALCGQSVAIGGVLFAIFLLRGPLADGPAARARLTRSLWL |
Ga0307469_103727652 | 3300031720 | Hardwood Forest Soil | VAGFVDVLLRGLALCGQAIAIGGVLFALLLLRPAFGEGGAARARL |
Ga0307468_1020132811 | 3300031740 | Hardwood Forest Soil | VAGFVDVLLRGLALCGQAIAIGGVLFALLLLRPALGEGGAA |
Ga0307473_108364512 | 3300031820 | Hardwood Forest Soil | VAGFVDVLLRGLALCGQAIAIGGVLFALLLLRPAFGEGGAAR |
Ga0307473_109627401 | 3300031820 | Hardwood Forest Soil | VAGFLDVVLRGLALAGQAMGMGGVLFALYVLRAATADGRAEE |
Ga0310892_105643351 | 3300031858 | Soil | VAAFADVILRGLALTGQAVAIGGILFALLVLRSRPDD |
Ga0310892_111778902 | 3300031858 | Soil | VAGFVDVLLRGLALCGQAIAIGGVLFALLLLRPALGEGGGARARLMRSLWL |
Ga0306923_105794102 | 3300031910 | Soil | VAGFVDVLLRGLALCGQSVAIGGVLFALLLRPGPLADGPAARARLIR |
Ga0318570_101517391 | 3300032054 | Soil | VAGFVDVLLRGLALCGQAVTVGGVFFALLLLRPALGDGAAARTRLSRSLALTAI |
Ga0318524_100159924 | 3300032067 | Soil | VAGFVDVLLRGLALCGQAVTVGGVFFALLLLRPALGDGAAART |
Ga0318524_105378481 | 3300032067 | Soil | VAGFVDVLLRGLALCGQSVAIGGVLFALLLRRGPLA |
Ga0310890_102001562 | 3300032075 | Soil | VAGFVDVLLRGLALCGQAIAIGGVLFALLLLRPALGEGG |
Ga0307470_117656281 | 3300032174 | Hardwood Forest Soil | VAGFIDVLLRGLALTGQAVAIGGVVFVLVVLRARQDDSGV |
Ga0307471_1004974871 | 3300032180 | Hardwood Forest Soil | VAEFVDVLLRGLALCGQAVAVGGVVFAALLLRPRAREAPAAR |
Ga0307472_1007821381 | 3300032205 | Hardwood Forest Soil | VAGFLDILLRGIALCGRAVAIGGIFFAVLVLRPTLSAR |
Ga0335084_101502543 | 3300033004 | Soil | MAGFLDVLLRGLALAGQAVALGGILFAVLVLRPAARQDPS |
Ga0364938_033751_702_839 | 3300034114 | Sediment | MAGFVDVLLRGLALCGQTVSVGGVFFAALLLRPASREDPAARSGLA |
Ga0364940_0018641_3_146 | 3300034164 | Sediment | MAGFVDVLLRGLALCGQVVAVGGVFFAALLLRPASREDPAARSRLARS |
⦗Top⦘ |