NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101795

Metagenome / Metatranscriptome Family F101795

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101795
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 37 residues
Representative Sequence MPHMIPAPGAFAAGVAIFLIVLWDAFEAIILPRRVTRKF
Number of Associated Samples 88
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 82.35 %
% of genes near scaffold ends (potentially truncated) 98.04 %
% of genes from short scaffolds (< 2000 bps) 91.18 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (76.471 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(34.314 % of family members)
Environment Ontology (ENVO) Unclassified
(30.392 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.843 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 43.28%    β-sheet: 0.00%    Coil/Unstructured: 56.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF02566OsmC 75.49
PF09844DUF2071 11.76
PF04342DMT_6 3.92
PF12849PBP_like_2 1.96
PF01040UbiA 0.98
PF00731AIRC 0.98
PF05016ParE_toxin 0.98
PF04055Radical_SAM 0.98
PF07110EthD 0.98
PF07885Ion_trans_2 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 75.49
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 75.49
COG3169Uncharacterized membrane protein, DMT/DUF486 familyFunction unknown [S] 3.92

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms76.47 %
UnclassifiedrootN/A23.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002917|JGI25616J43925_10109257All Organisms → cellular organisms → Bacteria1135Open in IMG/M
3300004139|Ga0058897_10753089All Organisms → cellular organisms → Bacteria → Proteobacteria624Open in IMG/M
3300004618|Ga0068963_1220898All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300004631|Ga0058899_12248385All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300005618|Ga0068864_101296838All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae728Open in IMG/M
3300005944|Ga0066788_10104697All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300006172|Ga0075018_10508178All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300006796|Ga0066665_10510930All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300006796|Ga0066665_10618823All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300006893|Ga0073928_10034656All Organisms → cellular organisms → Bacteria4778Open in IMG/M
3300006893|Ga0073928_10894571All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300007258|Ga0099793_10390396All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae683Open in IMG/M
3300009038|Ga0099829_11287530All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae604Open in IMG/M
3300010122|Ga0127488_1027206All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300011120|Ga0150983_15621185Not Available651Open in IMG/M
3300011120|Ga0150983_15892273All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae537Open in IMG/M
3300011270|Ga0137391_11096345All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300012199|Ga0137383_10245158All Organisms → cellular organisms → Bacteria1313Open in IMG/M
3300012349|Ga0137387_10380536All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300012361|Ga0137360_10347380All Organisms → cellular organisms → Bacteria1241Open in IMG/M
3300012410|Ga0134060_1249211All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300012923|Ga0137359_10213355All Organisms → cellular organisms → Bacteria1724Open in IMG/M
3300012925|Ga0137419_10261899All Organisms → cellular organisms → Bacteria1307Open in IMG/M
3300012927|Ga0137416_10135895All Organisms → cellular organisms → Bacteria1905Open in IMG/M
3300015053|Ga0137405_1156924All Organisms → cellular organisms → Bacteria1459Open in IMG/M
3300015167|Ga0167661_1082762All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae579Open in IMG/M
3300016357|Ga0182032_11264981Not Available636Open in IMG/M
3300016371|Ga0182034_10491679All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300016404|Ga0182037_11220928Not Available661Open in IMG/M
3300017933|Ga0187801_10022870All Organisms → cellular organisms → Bacteria2141Open in IMG/M
3300018088|Ga0187771_11037131Not Available696Open in IMG/M
3300018468|Ga0066662_11316357All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae741Open in IMG/M
3300020199|Ga0179592_10118657All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300020579|Ga0210407_11447082Not Available508Open in IMG/M
3300020580|Ga0210403_10907689All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae694Open in IMG/M
3300021088|Ga0210404_10038956All Organisms → cellular organisms → Bacteria2177Open in IMG/M
3300021168|Ga0210406_10003392All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae17483Open in IMG/M
3300021168|Ga0210406_10831959All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300021168|Ga0210406_11260966All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae534Open in IMG/M
3300021178|Ga0210408_11287808All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae555Open in IMG/M
3300021178|Ga0210408_11332842Not Available543Open in IMG/M
3300021403|Ga0210397_11287776All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300021406|Ga0210386_11750886All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300021407|Ga0210383_11043485All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae692Open in IMG/M
3300021407|Ga0210383_11591544All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae538Open in IMG/M
3300021420|Ga0210394_11563959Not Available556Open in IMG/M
3300021432|Ga0210384_10624047All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300021432|Ga0210384_11279686All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae638Open in IMG/M
3300021476|Ga0187846_10302274All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae662Open in IMG/M
3300021477|Ga0210398_10593543All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300021478|Ga0210402_10773350All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300021479|Ga0210410_10007794All Organisms → cellular organisms → Bacteria → Acidobacteria9254Open in IMG/M
3300021559|Ga0210409_10054485All Organisms → cellular organisms → Bacteria3750Open in IMG/M
3300022532|Ga0242655_10165147Not Available657Open in IMG/M
3300022532|Ga0242655_10171916All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae647Open in IMG/M
3300022533|Ga0242662_10218782Not Available606Open in IMG/M
3300022533|Ga0242662_10219673Not Available605Open in IMG/M
3300022533|Ga0242662_10267655All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae560Open in IMG/M
3300022726|Ga0242654_10241652Not Available644Open in IMG/M
3300024330|Ga0137417_1427942All Organisms → cellular organisms → Bacteria4655Open in IMG/M
3300026515|Ga0257158_1099903All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae573Open in IMG/M
3300026548|Ga0209161_10178964All Organisms → cellular organisms → Bacteria1199Open in IMG/M
3300026800|Ga0207742_114331Not Available591Open in IMG/M
3300026909|Ga0207858_1004403Not Available1456Open in IMG/M
3300026909|Ga0207858_1005171All Organisms → cellular organisms → Bacteria1342Open in IMG/M
3300027512|Ga0209179_1098678All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae650Open in IMG/M
3300027610|Ga0209528_1023486All Organisms → cellular organisms → Bacteria1358Open in IMG/M
3300027643|Ga0209076_1032903All Organisms → cellular organisms → Bacteria1449Open in IMG/M
3300027667|Ga0209009_1198477Not Available507Open in IMG/M
3300027671|Ga0209588_1073764All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae1102Open in IMG/M
3300027674|Ga0209118_1003092All Organisms → cellular organisms → Bacteria6867Open in IMG/M
3300027674|Ga0209118_1100452Not Available818Open in IMG/M
3300027729|Ga0209248_10045118All Organisms → cellular organisms → Bacteria1358Open in IMG/M
3300027846|Ga0209180_10202813All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300027846|Ga0209180_10215263All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300027862|Ga0209701_10158262All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300027882|Ga0209590_10016006All Organisms → cellular organisms → Bacteria3667Open in IMG/M
3300027903|Ga0209488_11214558All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae507Open in IMG/M
3300027908|Ga0209006_10251028All Organisms → cellular organisms → Bacteria1522Open in IMG/M
3300029944|Ga0311352_10381440All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300030847|Ga0075405_11287448Not Available695Open in IMG/M
3300030991|Ga0073994_10071212All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300031027|Ga0302308_10509729All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae706Open in IMG/M
3300031590|Ga0307483_1021459All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae635Open in IMG/M
3300031719|Ga0306917_11545940Not Available510Open in IMG/M
3300031744|Ga0306918_11425426Not Available530Open in IMG/M
3300031753|Ga0307477_10851362All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae604Open in IMG/M
3300031754|Ga0307475_10801240All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae747Open in IMG/M
3300031771|Ga0318546_10643862Not Available746Open in IMG/M
3300031792|Ga0318529_10147495All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300031845|Ga0318511_10361614All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae662Open in IMG/M
3300031879|Ga0306919_11014660Not Available634Open in IMG/M
3300031912|Ga0306921_10518908All Organisms → cellular organisms → Bacteria1384Open in IMG/M
3300031941|Ga0310912_10723501All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300031942|Ga0310916_11165307Not Available638Open in IMG/M
3300032001|Ga0306922_10897099All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae921Open in IMG/M
3300032054|Ga0318570_10486682All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae563Open in IMG/M
3300032076|Ga0306924_12050218Not Available588Open in IMG/M
3300032829|Ga0335070_10565734All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300032892|Ga0335081_12593894Not Available520Open in IMG/M
3300033158|Ga0335077_10786360All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae970Open in IMG/M
3300033289|Ga0310914_11808813Not Available515Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil34.31%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil19.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.82%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil8.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.94%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.96%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.96%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.98%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.98%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.98%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.98%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.98%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.98%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004139Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004618Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300010122Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015167Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026800Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 43 (SPAdes)EnvironmentalOpen in IMG/M
3300026909Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes)EnvironmentalOpen in IMG/M
3300027512Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027610Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030847Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031590Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25616J43925_1010925713300002917Grasslands SoilMPHMIPAPGAFIVGVAIFLIVVWDAFEAIILPRRVTRKFR
Ga0058897_1075308923300004139Forest SoilMPHMIPFPGAFVAGALIFLIVIWDAFEAIILPRRVTRKFR
Ga0068963_122089823300004618Peatlands SoilMLRMIPAPGVFIAGVLLFLLVAWDAFEAIILPRRVTRKFR
Ga0058899_1224838513300004631Forest SoilMPHMIPAPGAFIAGVAIFLIVLWDAFEAIILPRRVTRKFR
Ga0068864_10129683823300005618Switchgrass RhizosphereMPHMIPFPVPFAAGVAIFMIVLWDAFESVILPRRVTRK
Ga0066788_1010469713300005944SoilMIPVPGAFLTGIAIFFIVIWDAFESVILPRRVTRKFR
Ga0075018_1050817823300006172WatershedsMPHMIPVPGAFAVGVAIFLIVLWDAFEAIILPRRVTRKF
Ga0066665_1051093013300006796SoilMLTSPAAFLTGVAILIIVVWDAFEVIILPRRVTRRFRL
Ga0066665_1061882333300006796SoilMPHMIPAPGAFAAGVAIFLIVLWDAFEAIILPRRVTRKF
Ga0073928_1003465613300006893Iron-Sulfur Acid SpringMIPAPGAFLAGIAIFLIVVWDAFESIILPRRVTRKFR
Ga0073928_1089457123300006893Iron-Sulfur Acid SpringMTSAIPAPGEFLAGVMLFLIVVWDAFEAIILPRRV
Ga0099793_1039039613300007258Vadose Zone SoilMTSVIPYPGEFVVGVAAFLIVVWDAFEAIILPRRVT
Ga0099829_1128753013300009038Vadose Zone SoilMPHMIPTPGTFAAGVAIFLIVIWDAFEAIILPRRVTRKF
Ga0127488_102720613300010122Grasslands SoilMPHMIPAPGAFAAGVAIFLIVLWDAFEAIILPRRVTRK
Ga0150983_1562118523300011120Forest SoilMILAPGVFIAGVVIFLIVLWDAFEAIILPRRVTRK
Ga0150983_1589227313300011120Forest SoilMIPAPGAFLAGVAIFLIVLWDAFEAIILPRRVTRK
Ga0137391_1109634533300011270Vadose Zone SoilMPHMIPAPGAFVAGVAIFLIVLWEAFEAIILPRRVT
Ga0137383_1024515833300012199Vadose Zone SoilMQHMISAPGAFAAGVAIFLIVLWDAFEAIILPRRVTR
Ga0137387_1038053613300012349Vadose Zone SoilMPHMIPAPGAFALGVAIFLIVVWDAFEAVILPRRVT
Ga0137360_1034738013300012361Vadose Zone SoilMPHMIPAPGAFAAGVALFLIVLWDAFEAIILPRRVTRK
Ga0134060_124921133300012410Grasslands SoilMPHMIPAPGAFAAGVAIFLIVLWDAFEAIILPRRVTR
Ga0137359_1021335543300012923Vadose Zone SoilMTSVIPAPGEFLAGVALFLIVVWDAFEAIILPRRV
Ga0137419_1026189933300012925Vadose Zone SoilMQHMISAPGAFAAGVAIFLIVLWDAFEAIILPRRVTRKFR
Ga0137416_1013589553300012927Vadose Zone SoilMILAPGVFIAGVVIFLIVIWDAFEAIILPRRVTRK
Ga0137405_115692433300015053Vadose Zone SoilMPHMIPAPGAFIAGVATFAIVLWDAFEAIILPRRV
Ga0167661_108276213300015167Glacier Forefield SoilMLPSPAAFIAGVAILIIVVWDAFEAIILPRRVTRQFRLN
Ga0182032_1126498113300016357SoilMIPVPGAFVAGVAVFLVVAWDAFEAIILPRRETREFR
Ga0182034_1049167933300016371SoilMIPAPGAFIAGLVVFLVVAWDAFEAIILPRRVTRRFRL
Ga0182037_1122092823300016404SoilMLRMIPAPGVFVAGVVIFLVVVWDAFEAIILPRRV
Ga0187801_1002287063300017933Freshwater SedimentMPHMIPVPGAFAVGVAIFLIVLWDAFEAIILPRRVT
Ga0187771_1103713123300018088Tropical PeatlandMLRMIPVPGVFLAGIAVFLLVAWDAFEAIILPRRVTRKFRL
Ga0066662_1131635713300018468Grasslands SoilMPHMIPAPGAFAAGVAIFLIVVWDAFESIILPRRVTRKFR
Ga0179592_1011865713300020199Vadose Zone SoilMPHMIPAPGAFAAGVAIFVIVVWDAFEAIILPRRVTR
Ga0210407_1144708223300020579SoilMPHMIPSSGAFAAGAAIFLIVLWDAFEAIILPRRVT
Ga0210403_1090768923300020580SoilMPPMIPAPGAFLAGIAIFLIVVWDAFESIILPRRVTRKF
Ga0210404_1003895613300021088SoilMPHMLSAPGAFAVGVAIFLIVLWDAFEAIILPRRV
Ga0210406_1000339213300021168SoilMILAPGVFIAGVIIFLIVSWDAFEAIILPRRVTRK
Ga0210406_1083195913300021168SoilMPHMIPAPGAFIAGVAIFAIVLWDAFEAIILPRRVTRRFR
Ga0210406_1126096623300021168SoilMPSVLPAPGAFVAGAALFSIVLWDAFEAIILPRRVTRKFR
Ga0210408_1128780813300021178SoilMIPAPGAFAAGLAIFLIVIWDAFEAIILPRRVTRK
Ga0210408_1133284213300021178SoilMILAPGVFIAGVVIFLIVLWDAFEAIILPRRVTRKFR
Ga0210397_1128777613300021403SoilMQQLIPNPGAFVAGIVIFLVVVWDAFESIILPRRV
Ga0210386_1175088623300021406SoilMQHVIPNPGAFVAGIAIFLIVVWDAFEAIILPRRVTR
Ga0210383_1104348513300021407SoilMQHVIPVPGAFVAGILIFLIVVWDAFEAIILPRRVT
Ga0210383_1159154413300021407SoilMNTVSHMIPEPGVFLLGVALFMFVIWDAFEAIILPRRVTRKFRF
Ga0210394_1156395913300021420SoilMLAMIPVPGVFIAGVVLFFVVIWDAFEAIILPRRVTRK
Ga0210384_1062404713300021432SoilMILAPGVFIAGLVIFFIVSWDAFEAIILPRRVTRKFRLA
Ga0210384_1127968623300021432SoilMPHMIPLPVPFAAGVAIFMIVLWDAFESIILPRRVTRKF
Ga0187846_1030227413300021476BiofilmMPHMIPAPGAFAAGVAIFAIVVWDAFEAIILPRRVTRR
Ga0210398_1059354333300021477SoilMPHMIPAPAAFIAGVAIFVIVLWDAFEAIILPRRVT
Ga0210402_1077335033300021478SoilMILAPGVFIAGVVIFFIVSWDAFEAIILPRRVTRKFRL
Ga0210410_10007794113300021479SoilMILAPGVFIAGILIFLIVSWDAFEAIILPRRVTRKIRLTRI
Ga0210409_1005448563300021559SoilMPHMIPFPGAFVAGALIFLIVIWDAFEAIILPRRVTRKIRLT
Ga0242655_1016514723300022532SoilMILAPGVFIAGVVIFLIVLWDAFEAIILPRRVTRKFRL
Ga0242655_1017191613300022532SoilMPHMIQAPGAFIAGVAIFLIVLWDAFEAIILPRRVTRKFRF
Ga0242662_1021878223300022533SoilMILAPGVFIAGVVIFLIVIWDAFEAIILPRRVTRKFR
Ga0242662_1021967323300022533SoilMILAPGVFIAGILIFLTVTWDAFEAIILPRRVTRKVR
Ga0242662_1026765523300022533SoilMHQMIPAPGAFLAGVAIFLIVLWDAFEAIILPRRVTRKFR
Ga0242654_1024165213300022726SoilMILAPGVFIAGVAIFLIVSWDAFEAIILPRRVTRKFR
Ga0137417_142794273300024330Vadose Zone SoilMLTSPAAFLIGVAILIIVVWDAFEVIILPRRVTRVFG
Ga0257158_109990323300026515SoilMIPAPGAFIAGFAIFLIVLWDAFEAIILPRRVTRKF
Ga0209161_1017896413300026548SoilMPHMIPFPVPFAAGVAIFMIVLWDAFESIILPRRVT
Ga0207742_11433113300026800Tropical Forest SoilMLRMIPAPGVFIAGVVTFLVVLWDAFEAIILPRRV
Ga0207858_100440343300026909Tropical Forest SoilMLRMIPTPGVFIAGVAIFLVVVWDAFEAIILPRRVT
Ga0207858_100517113300026909Tropical Forest SoilMIPVPGAFIAGVAVFLVVAWDAFEAIILPRRVTRKF
Ga0209179_109867823300027512Vadose Zone SoilMTSVIPYPGEFAAGVAVFLVVVWDAFEAIILPRRV
Ga0209528_102348613300027610Forest SoilMTSVIPYPGEFAAGVALFLIVVWDAFEAIILPRRVTRK
Ga0209076_103290343300027643Vadose Zone SoilMPHMIPAPGAFAAGVAIFVIVVWDAFEAIILPRRVTRKF
Ga0209009_119847723300027667Forest SoilMLAMIPVPGVFIVGVALFFVVIWDAFEAIILPRRVTRKF
Ga0209588_107376413300027671Vadose Zone SoilMTSAISAPGEFLAGVALFLIVVWDAFEAIILPRRVTRKFR
Ga0209118_1003092113300027674Forest SoilMPHMISAPGAFAAGVAIFLIVLWDAFEAIILPRRVTRKFR
Ga0209118_110045223300027674Forest SoilMILAPGVFIAGVVIFLIVSWDAFEAIILPRRVTRKFRLARIY
Ga0209248_1004511833300027729Bog Forest SoilMNTVPHMIPEPGVFLLGVAMFMFVIWDAFEAIILPRRVTRKF
Ga0209180_1020281333300027846Vadose Zone SoilMIPVPGVFAAGVAIFLIVLWDAFEAIILPRRVTRKF
Ga0209180_1021526313300027846Vadose Zone SoilMPHMISAPGAFAAGVAIFLIVLWDAFEAIILPRRVTR
Ga0209701_1015826233300027862Vadose Zone SoilMPHMIPFLGAFAAGVALFLIVIWDAFEAIILPRRVTRR
Ga0209590_1001600613300027882Vadose Zone SoilMPHMIPAPGAFAAGVAIFLIVLWDAFEAIILPRRVTRKFR
Ga0209488_1121455823300027903Vadose Zone SoilMTSVIPYPGEFAAGVAVFLVVVWDAFEAIILPRRVTRKFRLT
Ga0209006_1025102813300027908Forest SoilMQHLIPAPGAFVAGIVIFLIVVWDAFESIILPRRVT
Ga0311352_1038144013300029944PalsaMPHMIPVPGIFILGVVIFLIVVWDAFEAIILPRRVTRKF
Ga0075405_1128744813300030847SoilMLRMIPAPGVFIAGVVIFLVVAWDAFEAIILPRRV
Ga0073994_1007121213300030991SoilMTSVIPYPGEFAADVALFLIVVWDAFEAIILPRRVTRKFR
Ga0302308_1050972923300031027PalsaMNTTPHIIPVPGVFILGVAVFWIVVWDAFEAIILPR
Ga0307483_102145923300031590Hardwood Forest SoilMIPAPGAFVAGVVVFLVVAWDSFEAIILPRRVTRKF
Ga0306917_1154594013300031719SoilMIPVPGAFVAGVAVFLVVAWDAFEAIILPRRVTRK
Ga0306918_1142542623300031744SoilMIPAPGAFIAGVVVFLVVAWDAFEAIILPRRVTRKFRLT
Ga0307477_1085136223300031753Hardwood Forest SoilMATAIPYPGVFAVGVALFLIVVWDAFEAIILPRRVTR
Ga0307475_1080124033300031754Hardwood Forest SoilMLSMPPAPGAFVAGAALFLIVLWDAFEAIILPRRV
Ga0318546_1064386213300031771SoilMLRMIPVPGIFIAGVAVFLVVVWDAFESVILPRRVTRRFR
Ga0318529_1014749513300031792SoilMIPAPGAFIAGVVVFLVVAWDAFEAIILPRRVTRKF
Ga0318511_1036161413300031845SoilMPHMIPAPGTFAAGAGLFLIVLWDAFESIILPRRVTRRF
Ga0306919_1101466023300031879SoilMIPVPGAFVAGVAVFLVVAWDAFEAIILPRRVTRKFR
Ga0306921_1051890813300031912SoilMLGMIPAPGVFLCGVAIFLIVLWDAFEAIILPRRVTRRF
Ga0310912_1072350133300031941SoilMLTSPAAFFLGVAILVVVVWDAFEVIILPRRVTRRF
Ga0310916_1116530713300031942SoilMIPAPGAFIAGLVVFLVVAWDAFEAIILPRRVTRRF
Ga0306922_1089709933300032001SoilMILAPGVFVAGIAIFLFVIWDAFEAIILPRRVTRKFRLARF
Ga0318570_1048668213300032054SoilMPHMIPAPGTFAAGVAVFLIVLWDAFESIILPRRVTRRF
Ga0306924_1205021813300032076SoilMIPVPGVFLCGVVLFLVVLWDAFEAIILPRRVTRKF
Ga0335070_1056573413300032829SoilMLRMIPVPGVFLAGIAVFLVVAWDAFEAIILPRRVTRR
Ga0335081_1259389413300032892SoilMILRPGVFLAGVAIFYLVAWDAFEAIILPRRVTRKIR
Ga0335077_1078636013300033158SoilMHGMIPHPLVFAAGFAIFVIVLWDAFESIILPRRVTR
Ga0310914_1180881313300033289SoilMIPVPGAFVAGVAVFLVVAWDAFEAIILPRRVTRKFRL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.