NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101782

Metagenome / Metatranscriptome Family F101782

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101782
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 46 residues
Representative Sequence RRKSRGARLTLIPVDARVWNAHMPLDAPAIAKTLLARLKSGA
Number of Associated Samples 93
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 2.02 %
% of genes near scaffold ends (potentially truncated) 95.10 %
% of genes from short scaffolds (< 2000 bps) 92.16 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (67.647 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(12.745 % of family members)
Environment Ontology (ENVO) Unclassified
(41.176 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(50.980 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.86%    β-sheet: 0.00%    Coil/Unstructured: 77.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF00005ABC_tran 87.25
PF08352oligo_HPY 6.86
PF07690MFS_1 0.98
PF12773DZR 0.98
PF05163DinB 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A67.65 %
All OrganismsrootAll Organisms32.35 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002560|JGI25383J37093_10085063Not Available951Open in IMG/M
3300003541|JGI20214J51650_10683941Not Available719Open in IMG/M
3300004153|Ga0063455_101701325Not Available501Open in IMG/M
3300004633|Ga0066395_10531266Not Available682Open in IMG/M
3300005293|Ga0065715_10765973Not Available563Open in IMG/M
3300005339|Ga0070660_101355842Not Available604Open in IMG/M
3300005353|Ga0070669_100680234All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300005364|Ga0070673_102029927Not Available546Open in IMG/M
3300005440|Ga0070705_101152502Not Available637Open in IMG/M
3300005441|Ga0070700_100485117All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1948Open in IMG/M
3300005518|Ga0070699_100983131Not Available774Open in IMG/M
3300005526|Ga0073909_10714172Not Available504Open in IMG/M
3300005535|Ga0070684_101569719Not Available621Open in IMG/M
3300005536|Ga0070697_101215498All Organisms → cellular organisms → Bacteria → Acidobacteria672Open in IMG/M
3300005539|Ga0068853_101554444Not Available641Open in IMG/M
3300005543|Ga0070672_100089252All Organisms → cellular organisms → Bacteria2483Open in IMG/M
3300005842|Ga0068858_101573264Not Available649Open in IMG/M
3300005843|Ga0068860_102143938All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300005844|Ga0068862_101379725All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1708Open in IMG/M
3300005938|Ga0066795_10112295All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300006034|Ga0066656_10070833All Organisms → cellular organisms → Bacteria2059Open in IMG/M
3300006172|Ga0075018_10743042Not Available534Open in IMG/M
3300006580|Ga0074049_12831187All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1922Open in IMG/M
3300006806|Ga0079220_10907627All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300006880|Ga0075429_100976055Not Available741Open in IMG/M
3300006904|Ga0075424_101507150Not Available714Open in IMG/M
3300007265|Ga0099794_10571651Not Available597Open in IMG/M
3300009090|Ga0099827_11073936Not Available699Open in IMG/M
3300009090|Ga0099827_11312854Not Available629Open in IMG/M
3300009098|Ga0105245_12359414Not Available586Open in IMG/M
3300009156|Ga0111538_11570269Not Available829Open in IMG/M
3300009162|Ga0075423_10296344All Organisms → cellular organisms → Bacteria1695Open in IMG/M
3300009176|Ga0105242_10612461All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-11053Open in IMG/M
3300009545|Ga0105237_10966441Not Available859Open in IMG/M
3300009649|Ga0105855_1217407Not Available579Open in IMG/M
3300009789|Ga0126307_10740108All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300009840|Ga0126313_10883758Not Available729Open in IMG/M
3300010358|Ga0126370_11772196Not Available596Open in IMG/M
3300010358|Ga0126370_12149844Not Available549Open in IMG/M
3300010400|Ga0134122_11538199All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300010403|Ga0134123_10750956All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium961Open in IMG/M
3300011119|Ga0105246_11144612Not Available713Open in IMG/M
3300012208|Ga0137376_10190689All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1772Open in IMG/M
3300012209|Ga0137379_11301400All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium632Open in IMG/M
3300012212|Ga0150985_102619736All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-11096Open in IMG/M
3300012212|Ga0150985_106447978Not Available570Open in IMG/M
3300012212|Ga0150985_116545369All Organisms → cellular organisms → Bacteria → Acidobacteria1163Open in IMG/M
3300012350|Ga0137372_10813310Not Available670Open in IMG/M
3300012469|Ga0150984_104399586Not Available602Open in IMG/M
3300012469|Ga0150984_105055027All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300012685|Ga0137397_10968620Not Available628Open in IMG/M
3300012685|Ga0137397_11052321Not Available596Open in IMG/M
3300012922|Ga0137394_10071756All Organisms → cellular organisms → Bacteria2886Open in IMG/M
3300012922|Ga0137394_10511088All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300012925|Ga0137419_11669095Not Available543Open in IMG/M
3300012961|Ga0164302_10738186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → unclassified Microbacterium → Microbacterium sp. SA39735Open in IMG/M
3300012971|Ga0126369_12691843Not Available581Open in IMG/M
3300012984|Ga0164309_11732816Not Available536Open in IMG/M
3300015171|Ga0167648_1068518All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium784Open in IMG/M
3300015264|Ga0137403_10974332Not Available696Open in IMG/M
3300015374|Ga0132255_104089447All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300017792|Ga0163161_11777434Not Available548Open in IMG/M
3300018028|Ga0184608_10417033Not Available581Open in IMG/M
3300018060|Ga0187765_10874874Not Available606Open in IMG/M
3300018066|Ga0184617_1091635All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1838Open in IMG/M
3300019890|Ga0193728_1200273Not Available839Open in IMG/M
3300020000|Ga0193692_1112879Not Available560Open in IMG/M
3300020010|Ga0193749_1049122Not Available810Open in IMG/M
3300021080|Ga0210382_10486842Not Available546Open in IMG/M
3300021953|Ga0213880_10232901Not Available526Open in IMG/M
3300022756|Ga0222622_10039961All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis2576Open in IMG/M
3300022756|Ga0222622_11031257Not Available605Open in IMG/M
3300025581|Ga0208355_1014662All Organisms → cellular organisms → Bacteria → Acidobacteria2477Open in IMG/M
3300025914|Ga0207671_11144694Not Available610Open in IMG/M
3300025919|Ga0207657_10879226Not Available691Open in IMG/M
3300025927|Ga0207687_11181750Not Available657Open in IMG/M
3300025940|Ga0207691_11226057Not Available621Open in IMG/M
3300025940|Ga0207691_11764165Not Available500Open in IMG/M
3300025941|Ga0207711_11936736Not Available532Open in IMG/M
3300025960|Ga0207651_11025635Not Available738Open in IMG/M
3300025986|Ga0207658_10535322Not Available1047Open in IMG/M
3300026041|Ga0207639_11115518Not Available740Open in IMG/M
3300026118|Ga0207675_102072351Not Available586Open in IMG/M
3300027874|Ga0209465_10594331Not Available548Open in IMG/M
3300027882|Ga0209590_10970565Not Available531Open in IMG/M
3300027910|Ga0209583_10562410Not Available574Open in IMG/M
3300028792|Ga0307504_10205314Not Available700Open in IMG/M
3300028807|Ga0307305_10108695All Organisms → cellular organisms → Bacteria1281Open in IMG/M
3300028828|Ga0307312_11100178Not Available526Open in IMG/M
3300031231|Ga0170824_107169905Not Available515Open in IMG/M
3300031239|Ga0265328_10136885Not Available918Open in IMG/M
3300031469|Ga0170819_14281897Not Available514Open in IMG/M
3300031474|Ga0170818_114092464All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-11128Open in IMG/M
3300031544|Ga0318534_10076058All Organisms → cellular organisms → Bacteria1904Open in IMG/M
3300032163|Ga0315281_11636405Not Available626Open in IMG/M
3300032180|Ga0307471_100645818All Organisms → cellular organisms → Bacteria1220Open in IMG/M
3300032205|Ga0307472_102536694Not Available522Open in IMG/M
3300032829|Ga0335070_11519462All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300034354|Ga0364943_0396826Not Available533Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.92%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.94%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.94%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere2.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.96%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.96%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.96%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.96%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.96%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.98%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.98%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.98%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.98%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.98%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908041Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300003541Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009649Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300015171Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020010Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021953Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025581Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P3_CLC_028052302124908041SoilLPISGAKVTVIPVDTRVWDAHIPVDAPAVVKNLLARLRGGT
JGI25383J37093_1008506323300002560Grasslands SoilRAIADQRRKSRGTKATLIPVDARNWDAHLPHDAPASAKTLLARVRTGA*
JGI20214J51650_1068394123300003541WetlandGDLAGEIADQRKKSRGAKVTLIPVDARVWDAHIPLDAPAIAKTLIARLKSGT*
Ga0063455_10170132523300004153SoilIAEQRRRSRGARLTLIPVDARVWDAHMPLDAPPIAKSLLARLKSGG*
Ga0066395_1053126613300004633Tropical Forest SoilAEITNQRRRSRGARLTIIPVDARVWHAHIPLDAPAIAKTLLTRLKSGS*
Ga0065715_1076597313300005293Miscanthus RhizosphereRQRGTRLTLIPVDARNWEAHMPIDAPGIAKTLLARLRTGT*
Ga0070660_10135584223300005339Corn RhizosphereRAGGGKLVLIPVDARDWEARMPLDAPPIAKTLLARLRSGT*
Ga0070669_10068023423300005353Switchgrass RhizosphereDQRRKSRGAKVTVIPVDARVWDARMPLDAPAVAKALLAHLKSGS*
Ga0070673_10202992723300005364Switchgrass RhizosphereRRKSRGARLTLIPVDARVWNAHMPLDAPAIAKTLLARLKSGA*
Ga0070705_10115250223300005440Corn, Switchgrass And Miscanthus RhizosphereKHGKAGGGKLVLIPVDARDWDARMPLDAPPIAKTLLAKLKSGT*
Ga0070700_10048511713300005441Corn, Switchgrass And Miscanthus RhizospherePAGELAGEIAGQRRKSRGAKVTLIPVDVSIWHAHMPLDAPEIAKSLIAKLKSGG*
Ga0070699_10098313123300005518Corn, Switchgrass And Miscanthus RhizosphereAGGGKLVLIPVDARDWDARMPLDAPPIAKTLLAKLKSGT*
Ga0073909_1071417213300005526Surface SoilALVPAGELAGEIADQRRKSRGARVTLIPVDARVWNAHMPLDAPAIAKTLVARLKSGT*
Ga0070684_10156971923300005535Corn RhizosphereSRGAKITLIPVDARIWNAHMPLDAPAIAKTLLARLKSGT*
Ga0070697_10121549813300005536Corn, Switchgrass And Miscanthus RhizosphereRKKSRSKVTLIPVDARDWAAHIPTDAPDVAKNLLARLKGGT*
Ga0068853_10155444413300005539Corn RhizosphereRRSRGARLSIIPVDARVWHAHIPLDAPAVAKTLLTRLKSGS*
Ga0070672_10008925213300005543Miscanthus RhizosphereGLTLIPVDARNWEAHMPLDAPAIAKTLLARLRTGA*
Ga0068858_10157326423300005842Switchgrass RhizosphereAELAREITDQRRKSRGAKVTVIPVDARVWDARMPLDAPAVAKTLLARLKSGS*
Ga0068860_10214393813300005843Switchgrass RhizosphereRRRPSRGCKVTLIPVDASVWSAHMPLDAPGVAKDLLTRLRSNV*
Ga0068862_10137972523300005844Switchgrass RhizosphereELAREITEQRRKSRGAKVTVIPVDARVWDARMPLDAPAVAKALIAHLKSGS*
Ga0066795_1011229523300005938SoilIQRKKQARDSKLTLIPVDARNWDAHMPLGAPAIAKTLLARLKSGG*
Ga0066656_1007083333300006034SoilLQRRKQPRTGGKLTLIPVDARVWDAHMPFDAPAIAKTLLARLKSGG*
Ga0075018_1074304213300006172WatershedsGELGGEITDQRRKSRGAKLTLIPVDARVWHAHMPLDAPAIAKTLLARLKSGT*
Ga0074049_1283118713300006580SoilPAGELAGEIASQRRKSRGARLTLIPVDARVWHAHMPLDAPPIAKTLLTRLKSGS*
Ga0079220_1090762713300006806Agricultural SoilKRKAGNVTLIPVDARDWAAHIPTDAPDVAKNLLARLKGGT*
Ga0075429_10097605513300006880Populus RhizosphereARAIAEQRRRQRGTRLTLIPVDARNWEAHMPLDAPGIAKTLLTRLRTGA*
Ga0075424_10150715013300006904Populus RhizosphereQRRKSRGAKATVIPIDARNWDARLPTDAPDVAKTLLTRLKSGG*
Ga0099794_1057165123300007265Vadose Zone SoilLLMGTSLSPAGELAVEIALQRRKQPRTGGKLTLIPVDARVWEAHMPFDAPVIAKTLLARLKSGV*
Ga0099827_1107393623300009090Vadose Zone SoilLSPAAELAGEIALQRRKQPRTGGKLTLIPVDARVWDAHMPFDAPAIAKTLLARLKSGG*
Ga0099827_1131285413300009090Vadose Zone SoilTTNVTLIPVDARTWDAHMPLDAPVIAKTLLARLKAGQ*
Ga0105245_1235941413300009098Miscanthus RhizosphereAREITEQRRKSRGAKVTVIPVDARVWDARMPLDAPAIAKALLAHLKSGS*
Ga0111538_1157026913300009156Populus RhizosphereQRRRLRGTRLTLIPVDASNWEAHVPLDAPGIAKTLLARLRTGA*
Ga0075423_1029634433300009162Populus RhizosphereGGKLVLIPVDARDWEARMPLDAPPIAKTLLARLRSGT*
Ga0105242_1061246123300009176Miscanthus RhizosphereRKSRGARLTLIPVDAQVWHAHMPLDAPPIAKTLLTRLKSGS*
Ga0105237_1096644123300009545Corn RhizosphereSRGARLSIIPVDARVWHAHIPLDAPAVAKTLLTRLKSGS*
Ga0105855_121740713300009649Permafrost SoilKTRGAKVTLIPVDARVWDAHMPFDAPAVAKTLLARLKSGS*
Ga0126307_1074010823300009789Serpentine SoilMSERPLSELAREITDQRRKSRGAKVTVIPVDARVWDARMPLDAPAVAKALLAHLKSGS*
Ga0126313_1088375813300009840Serpentine SoilKLTLIPVDASTWSAHMPLDAPEIAKSLIARLKAGA*
Ga0126370_1177219623300010358Tropical Forest SoilVTLIPVDARDWGSYVPNDAPEIAKSLLARLKRGT*
Ga0126370_1214984423300010358Tropical Forest SoilKQNRAGGGKMVLIPVDARDWDARMPIDAPAIAKTLVARLKSGN*
Ga0134122_1153819913300010400Terrestrial SoilQRKKNRAKVTLIPVDARDWGAYIPNDAPEVAKSLLTRLKRGT*
Ga0134123_1075095613300010403Terrestrial SoilLTLIPVDARNWEAHMPLDAPAIAKTLLARLRTGA*
Ga0105246_1114461213300011119Miscanthus RhizosphereDQRRKSRGARVTLIPVDARVWTAHMPLDAPAVAKTLLARLKSGT*
Ga0137376_1019068913300012208Vadose Zone SoilMGTSLAPAGELAGEIADQRKRQPRKGGKLTLIPVDARVWDAYMPFDAPEIAKTLLARLRTGS*
Ga0137379_1130140013300012209Vadose Zone SoilAIAEQRKRQRGVKLVLIPIDARNWDAHMPIDAPPIARALSS*
Ga0150985_10261973633300012212Avena Fatua RhizosphereNRTGGRLVLIPVDARDWNARMPLDAPPIAKNLIERLKRGA*
Ga0150985_10644797823300012212Avena Fatua RhizosphereGELATDIRDQGRRQRGGKLVLIPVDARDWDAKMPLDAPPIAKTLIERLKKGA*
Ga0150985_11654536913300012212Avena Fatua RhizosphereGGRAGRRDRHQRRRSRAAKVTLIPVDARVWDAHMPLDAPPIAKTLLARLKSGS*
Ga0137372_1081331013300012350Vadose Zone SoilTDQRRKPTRGGRVVLIPIDARTWEAHMPTDAPALAKTLLTRLRSGT*
Ga0150984_10439958623300012469Avena Fatua RhizosphereRKSRTAKITLIPVDARNWDAYVPVDAPPVAKNVLARLRTGA*
Ga0150984_10505502713300012469Avena Fatua RhizosphereKSRAAKVTLIPVDARVWDAHMPLDAPAIAKALLARLKSGS*
Ga0137397_1096862023300012685Vadose Zone SoilARAIAEQRRKSRGAKATLIPVDARNWDAHLPTDAPANAKTRLPRVRSGT*
Ga0137397_1105232123300012685Vadose Zone SoilARAIAEQRRKSRGAKATLIPVDARNWDAHLPTDAPANAKTLLSRLRSGT*
Ga0137394_1007175613300012922Vadose Zone SoilRRKSRSTRTTLIPVDARNWDAHLPHDAPASAKTLLTRVRTGA*
Ga0137394_1051108833300012922Vadose Zone SoilSRSKVTLIPVDARDWAAHIPTDAPDVAKSLLAKLKGGT*
Ga0137419_1166909513300012925Vadose Zone SoilGELAGEIADQRRKARGLRLTLIPVDARVWDAHMPFDAPPIAKTLLTRLKSGA*
Ga0164302_1073818623300012961SoilGAGKLVLIPVDARDWEARMPLDAPPVAKTLLARLKSGT*
Ga0126369_1269184323300012971Tropical Forest SoilELATAINEQRRKPRSGKVTLIPVDARVWDARMPTDAPTIAKTVIARLRTGA*
Ga0164309_1173281613300012984SoilVTLIPVDARDWGAYIPNDAPEVAKSLLTRLKRGT*
Ga0167648_106851823300015171Glacier Forefield SoilPAGELAGEIADQRKKSRGAKLTLIPVDARIWNAHIPLDAPAIAKTLLSRLKSGT*
Ga0137403_1097433223300015264Vadose Zone SoilGTSLAPASELAGEIADQRKRQSRKGGKLTLIPVDARVWDAHMPFDAPEIAKTLLTRLRTGS*
Ga0132255_10408944713300015374Arabidopsis RhizosphereRGTRLTLIPVDARNWEAHMPLDAPGIAKTLLARLRTGA*
Ga0163161_1177743423300017792Switchgrass RhizosphereSRGARLTLIPVDARVWDAHMPLDAPAIAKSLIARLKAGR
Ga0187780_1106606123300017973Tropical PeatlandAKVTLIPVDLRDWDAHIPTDAPAVAKSLITRLRTGQ
Ga0184608_1041703313300018028Groundwater SedimentQRRRQRGAKLTLIPVDARNWDAHMPVDAPGIAKTLLARLRSGA
Ga0187765_1087487423300018060Tropical PeatlandMGTSLAGAGELAKAIAEQRRKQKNLKVTLIPVDARVWDAHMPLDAPDFAKNLIARLKRGN
Ga0184617_109163513300018066Groundwater SedimentKRQPRKGGKLTLIPVDARVWDAHMPFDAPEIAKTLLARLRTGS
Ga0193728_120027323300019890SoilRRKSRGAKVTLIPVDARVWNAHMPLDAPAIARTLLARLKSGT
Ga0193692_111287923300020000SoilAGELAGEIADQRRKSRGARVTLIPVDARVWNAHMPLDAPAIAKTLMARLKSGT
Ga0193749_104912213300020010SoilLLLGTTLASAGELGGEITDQRRKSRGARLTLIPVDARVWTAHMPLDAPPIAKTLLARLKSGT
Ga0210382_1048684213300021080Groundwater SedimentDQRRKSRSAKLTLIPVDARVWDAHMPLDAPPIAKSLLARLKTGA
Ga0213880_1023290123300021953Exposed RockALAGELATAIAEQRKRQRASKIALIPVDARNWDAHIPLDAPAFAKTLIARLKTGQ
Ga0222622_1003996113300022756Groundwater SedimentEIANQRRKWKGARLTLIPVDARVWDAHMPLDAPPIAKSLITRLKTGR
Ga0222622_1103125713300022756Groundwater SedimentAPAAELAREITDQRRKSRGAKVTVIPVDARVWDARMPLDAPAVAKALLAHLKSGS
Ga0208355_101466213300025581Arctic Peat SoilISAQRRKARAPGAKVTVIPVDTRVWDAHIPVDAPAAVKNLLARLRGGT
Ga0209540_1057613913300025888Arctic Peat SoilPGAKVTVIPVDTRVWDAHIPVDAPAAVKNLLARLRGGT
Ga0207671_1114469423300025914Corn RhizosphereSRGARLSIIPVDARVWHAHIPLDAPAVAKTLLTRLKSGS
Ga0207657_1087922623300025919Corn RhizosphereRAGGGKLVLIPVDARDWEARMPLDAPPIAKTLLARLRSGT
Ga0207687_1118175023300025927Miscanthus RhizosphereRKQRKGGKLTLIPVDASVWDAHMPFDAPEVAKTLLARLKSGG
Ga0207691_1122605723300025940Miscanthus RhizosphereGARLTVIPVDARVWDARMPLDAPAVAKALLAHLKSGS
Ga0207691_1176416523300025940Miscanthus RhizosphereAIAEQRRRQRGTRLTLIPVDARNWEAHMPLDAPGIAKTLLARLRTGA
Ga0207711_1193673623300025941Switchgrass RhizosphereGEINEQRKKARGAKLTLIPVDARIWNAHMPLDAPAIAKTLIARLKSGT
Ga0207651_1102563523300025960Switchgrass RhizosphereDQRRKSRGAKVTVIPVDARVWDARMPLDAPAVAKTLLAHLKSGS
Ga0207658_1053532213300025986Switchgrass RhizosphereARLTLIPVDARVWNAHMPLDAPAIAKTLLARLKSGA
Ga0207639_1111551813300026041Corn RhizosphereEITNQRRRSRGARLSIIPVDARVWHAHIPLDAPAVAKTLLTRLKSGS
Ga0207675_10207235113300026118Switchgrass RhizosphereADQRRKSRGARLTLIPVDARVWDAHMPLDAPPIAKSLLTKLKRGG
Ga0209465_1059433113300027874Tropical Forest SoilLAAEITNQRRRSRGARLTIIPVDARVWHAHIPLDAPAIAKTLLTRLKSGS
Ga0209590_1097056523300027882Vadose Zone SoilTTNVTLIPVDARTWDAHMPLDAPVIAKTLLARLKAGQ
Ga0209583_1056241013300027910WatershedsASSPAGEIADQRRKSRGARLTLIPIDARVWDAHMPLDAPAVAKTLLARLKSGT
Ga0307504_1020531413300028792SoilARTGRQLTLIPVDARVWDAHMPFDAPAIAKTLLARLKSGG
Ga0307305_1010869513300028807SoilPAGELAVEIALQRRKQPRTGGKLTLIPVDARVWDAHMPFDAPAIAKTLLVRLKSGV
Ga0307312_1110017823300028828SoilRGVNLTLIPVDAGVWDAHMPFDAPAIAKTLLARLKSGA
Ga0170824_10716990513300031231Forest SoilPAGELAGEIANQRRKSRGSRLTLIPVDAQVWHAHMPLDAPPIAKTLLMRLKSGS
Ga0265328_1013688523300031239RhizosphereRRIRNSKVTLIPVDARDWAAHIPTDAPDIVKILLAKLKSGT
Ga0170819_1428189713300031469Forest SoilDEVCVFLMGTSIAPAGELGGEIASQRRKQRSTKVTLIPIDARDWEALMPLDAPPIAKTLLTRLKSGS
Ga0170818_11409246413300031474Forest SoilPAGELAGEIASQRRKSRGSRLTLIPVDAQVWHAHMPLDAPPIAKTLLMRLKSGS
Ga0318534_1007605813300031544SoilQRRRAARGGSRVTLIPVDARDWDARMPTDAPPVAKTLLTRLRTGA
Ga0315281_1163640513300032163SedimentLGELAGEIADQRRKSRGAKVTLIPVDARVWDAHMPLDAPAFAKTLLARLKSGT
Ga0307471_10064581833300032180Hardwood Forest SoilAGELAGEIANQRRRSRGAKLTLIPVDASIWSAHMPLDAPDIAKTLIARLKSGG
Ga0307472_10253669423300032205Hardwood Forest SoilQRRKSRGAAATLIPVDARNWDAHLPTDAPENAKTLLARVRSGT
Ga0335070_1151946223300032829SoilKGANVTLIPIDARDWAAHIPTDAPEVAKNLLTRLKGGT
Ga0364943_0396826_3_1373300034354SedimentKRQPRKGGGKLTLIPVDARVWDAHMPFDAPAIAKTLLARLRTGS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.