Basic Information | |
---|---|
Family ID | F101763 |
Family Type | Metagenome |
Number of Sequences | 102 |
Average Sequence Length | 44 residues |
Representative Sequence | GEEGTGWIDHWAITLGKPPQGAPVFPQWVIDRSKALGQPQP |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.02 % |
% of genes from short scaffolds (< 2000 bps) | 88.24 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (88.235 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.647 % of family members) |
Environment Ontology (ENVO) | Unclassified (41.176 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.020 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 0.00% Coil/Unstructured: 75.36% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF01654 | Cyt_bd_oxida_I | 12.75 |
PF00759 | Glyco_hydro_9 | 3.92 |
PF00578 | AhpC-TSA | 3.92 |
PF01182 | Glucosamine_iso | 3.92 |
PF08450 | SGL | 2.94 |
PF00754 | F5_F8_type_C | 2.94 |
PF13905 | Thioredoxin_8 | 2.94 |
PF02113 | Peptidase_S13 | 2.94 |
PF07244 | POTRA | 2.94 |
PF07593 | UnbV_ASPIC | 2.94 |
PF04185 | Phosphoesterase | 2.94 |
PF03737 | RraA-like | 1.96 |
PF13360 | PQQ_2 | 1.96 |
PF07883 | Cupin_2 | 1.96 |
PF01522 | Polysacc_deac_1 | 0.98 |
PF00535 | Glycos_transf_2 | 0.98 |
PF03853 | YjeF_N | 0.98 |
PF01842 | ACT | 0.98 |
PF04203 | Sortase | 0.98 |
PF13414 | TPR_11 | 0.98 |
PF00480 | ROK | 0.98 |
PF00069 | Pkinase | 0.98 |
PF01988 | VIT1 | 0.98 |
PF13378 | MR_MLE_C | 0.98 |
PF02367 | TsaE | 0.98 |
PF03450 | CO_deh_flav_C | 0.98 |
PF06439 | 3keto-disac_hyd | 0.98 |
PF02322 | Cyt_bd_oxida_II | 0.98 |
PF00072 | Response_reg | 0.98 |
PF01144 | CoA_trans | 0.98 |
PF00860 | Xan_ur_permease | 0.98 |
PF13432 | TPR_16 | 0.98 |
PF07221 | GlcNAc_2-epim | 0.98 |
PF13474 | SnoaL_3 | 0.98 |
PF13349 | DUF4097 | 0.98 |
PF01041 | DegT_DnrJ_EryC1 | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 12.75 |
COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 3.92 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.92 |
COG2027 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 2.94 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 2.94 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 2.94 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 2.94 |
COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 1.96 |
COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.96 |
COG0062 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domain | Nucleotide transport and metabolism [F] | 0.98 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.98 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.98 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.98 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
COG0802 | tRNA A37 threonylcarbamoyladenosine biosynthesis protein TsaE | Translation, ribosomal structure and biogenesis [J] | 0.98 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.98 |
COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.98 |
COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.98 |
COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.98 |
COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.98 |
COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.98 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.98 |
COG2942 | Mannose or cellobiose epimerase, N-acyl-D-glucosamine 2-epimerase family | Carbohydrate transport and metabolism [G] | 0.98 |
COG3764 | Sortase (surface protein transpeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.24 % |
Unclassified | root | N/A | 11.76 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000955|JGI1027J12803_101223842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1010 | Open in IMG/M |
3300001990|JGI24737J22298_10043952 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
3300002560|JGI25383J37093_10157399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300004152|Ga0062386_100560324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
3300004479|Ga0062595_100589820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
3300005167|Ga0066672_10009849 | All Organisms → cellular organisms → Bacteria | 4542 | Open in IMG/M |
3300005184|Ga0066671_10005604 | All Organisms → cellular organisms → Bacteria | 4597 | Open in IMG/M |
3300005327|Ga0070658_10042290 | All Organisms → cellular organisms → Bacteria | 3680 | Open in IMG/M |
3300005437|Ga0070710_10097379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1746 | Open in IMG/M |
3300005445|Ga0070708_100370924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1349 | Open in IMG/M |
3300005445|Ga0070708_101522537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
3300005518|Ga0070699_100166107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1955 | Open in IMG/M |
3300005518|Ga0070699_101257325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 679 | Open in IMG/M |
3300005530|Ga0070679_100313175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1519 | Open in IMG/M |
3300005557|Ga0066704_10630539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
3300005842|Ga0068858_100120498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 2453 | Open in IMG/M |
3300005995|Ga0066790_10218861 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300006028|Ga0070717_10500005 | Not Available | 1099 | Open in IMG/M |
3300006102|Ga0075015_100840839 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300006162|Ga0075030_100147666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1904 | Open in IMG/M |
3300006173|Ga0070716_100214277 | Not Available | 1289 | Open in IMG/M |
3300006358|Ga0068871_101751294 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300006791|Ga0066653_10525225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
3300006796|Ga0066665_11030250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 629 | Open in IMG/M |
3300006797|Ga0066659_11909232 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300006854|Ga0075425_100725031 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
3300009012|Ga0066710_101539744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
3300009088|Ga0099830_10916642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
3300009088|Ga0099830_11198994 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300009098|Ga0105245_10175735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 2042 | Open in IMG/M |
3300009101|Ga0105247_10019234 | Not Available | 4099 | Open in IMG/M |
3300009101|Ga0105247_11595156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300009137|Ga0066709_100531938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1661 | Open in IMG/M |
3300009148|Ga0105243_12464757 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300009174|Ga0105241_11219845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
3300009176|Ga0105242_10007584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8353 | Open in IMG/M |
3300009176|Ga0105242_11051386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
3300009551|Ga0105238_10265030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1698 | Open in IMG/M |
3300009683|Ga0116224_10536140 | Not Available | 558 | Open in IMG/M |
3300010048|Ga0126373_12374083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300010335|Ga0134063_10276201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
3300010336|Ga0134071_10166410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1078 | Open in IMG/M |
3300010343|Ga0074044_11147043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300010358|Ga0126370_10883579 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300010364|Ga0134066_10458838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300010366|Ga0126379_12657239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300010375|Ga0105239_12884213 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300010396|Ga0134126_12332375 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300010401|Ga0134121_11640908 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300011269|Ga0137392_10705839 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300011269|Ga0137392_10902332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
3300011270|Ga0137391_11577997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300012201|Ga0137365_10791187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
3300012205|Ga0137362_11249302 | Not Available | 628 | Open in IMG/M |
3300012208|Ga0137376_10040844 | All Organisms → cellular organisms → Bacteria | 3747 | Open in IMG/M |
3300012351|Ga0137386_10539677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
3300012357|Ga0137384_10666274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
3300012357|Ga0137384_10983470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
3300012361|Ga0137360_10719891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 857 | Open in IMG/M |
3300012362|Ga0137361_11033604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
3300012918|Ga0137396_10935660 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300012927|Ga0137416_10627525 | Not Available | 938 | Open in IMG/M |
3300012929|Ga0137404_10615008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 978 | Open in IMG/M |
3300014969|Ga0157376_10323595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1467 | Open in IMG/M |
3300015372|Ga0132256_100288312 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
3300017966|Ga0187776_10204707 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
3300018027|Ga0184605_10450863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300018044|Ga0187890_10291601 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300018482|Ga0066669_11930986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300019789|Ga0137408_1086206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1676 | Open in IMG/M |
3300019879|Ga0193723_1028045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1705 | Open in IMG/M |
3300020004|Ga0193755_1008471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3352 | Open in IMG/M |
3300020062|Ga0193724_1057963 | Not Available | 815 | Open in IMG/M |
3300024246|Ga0247680_1040817 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300025321|Ga0207656_10531442 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300025910|Ga0207684_10961838 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300025914|Ga0207671_11320200 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300025921|Ga0207652_10162094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2005 | Open in IMG/M |
3300025929|Ga0207664_11219370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
3300025938|Ga0207704_11269021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
3300025972|Ga0207668_12161673 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300026095|Ga0207676_10387011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1303 | Open in IMG/M |
3300026298|Ga0209236_1157212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
3300026335|Ga0209804_1327990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300026538|Ga0209056_10361938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 940 | Open in IMG/M |
3300026538|Ga0209056_10379243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
3300027050|Ga0209325_1017787 | Not Available | 824 | Open in IMG/M |
3300027297|Ga0208241_1036894 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300027812|Ga0209656_10103792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1489 | Open in IMG/M |
3300027882|Ga0209590_10853588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300028673|Ga0257175_1018200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1142 | Open in IMG/M |
3300028828|Ga0307312_10871821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
3300031446|Ga0170820_11324080 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300031446|Ga0170820_12272148 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300031573|Ga0310915_10027998 | All Organisms → cellular organisms → Bacteria | 3492 | Open in IMG/M |
3300031797|Ga0318550_10540395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300031820|Ga0307473_11479276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300031823|Ga0307478_11495399 | Not Available | 559 | Open in IMG/M |
3300032205|Ga0307472_100914935 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300032782|Ga0335082_10785589 | Not Available | 814 | Open in IMG/M |
3300033158|Ga0335077_10812842 | Not Available | 951 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.80% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.84% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.92% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.94% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.94% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.96% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.96% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.96% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.96% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.96% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.98% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.98% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.98% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J12803_1012238422 | 3300000955 | Soil | GWLEHWAITQGKPPQGAPIFPQWVIDRNRALPRTQP* |
JGI24737J22298_100439521 | 3300001990 | Corn Rhizosphere | TYVGEEGTGWLDHWAIAQGKPPRGAPVFPQWVIDRSKALKLPQP* |
JGI25383J37093_101573991 | 3300002560 | Grasslands Soil | EEGTGWLDHWAITRGQPPQNAPVFPQWVIDRSKALPPHPQP* |
Ga0062386_1000796843 | 3300004152 | Bog Forest Soil | DEYVGEEGTSWLDHWAITRGHPPQNAPVFPQWVIDRANALPKGQPELPLFQ* |
Ga0062386_1005603242 | 3300004152 | Bog Forest Soil | GWIEHWAITRGRPPLNAPEFPEWVKDRYKALPPQPREEAIF* |
Ga0062595_1005898202 | 3300004479 | Soil | GTNWIDHWAITRGLPPQNTPVFPQWVIDRSKALPRPPTQP* |
Ga0066672_100098491 | 3300005167 | Soil | TYVGEEGRGWLDHWAISQGKPPQGGPVFPQWVMDRAQKLRRPQP* |
Ga0066671_100056041 | 3300005184 | Soil | EGTGWLEHWAITLGKPPQGAPSVPQWLNDRWTALHPDKP* |
Ga0070658_100422901 | 3300005327 | Corn Rhizosphere | EGTGWLDHWAIAQGKPPRGAPVFPQWVIDRSKALKLPQP* |
Ga0070710_100973792 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | YSLPDTYVGEEGTGWIDHWAITMGKPPQSGPEFPQWVLDLAKSLRQPQP* |
Ga0070708_1003709241 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GEEGTGWIEHWAITQGKIPQGAPVFPQAVIEKWKALAPTQP* |
Ga0070708_1015225371 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | YIGEEGTGWLDHWAITRGQPPQNAPVFPQWVIDRSKALPPHPQP* |
Ga0070699_1001661073 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LPDTYVGEEGTGWLEHWAISQGKIPQGAPAFPQAVIEKWKALAPTQP* |
Ga0070699_1012573251 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EGTGWLDHWAITQGKIPQGAPVFPQAVIEKWKALAPTQP* |
Ga0070679_1003131752 | 3300005530 | Corn Rhizosphere | IGEEGTNWIDHWAITRGQPPRNTPTFPQWVIDRSRALPRAPSQP* |
Ga0066704_106305391 | 3300005557 | Soil | EEGTSWIDHWAITRGHPPQNGPVFPQWVIDRSNALPQRPTQP* |
Ga0068858_1001204981 | 3300005842 | Switchgrass Rhizosphere | GEEGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP* |
Ga0066790_102188613 | 3300005995 | Soil | GWIEHWAITRGQPPRGTPEFPAWVLELWKALPRRPTQP* |
Ga0070717_105000052 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GTGWLEQWAITQGKPPQGAPTFPQWVSDRAKSLHQPQP* |
Ga0075015_1008408391 | 3300006102 | Watersheds | LPDTYVGEEGTGWLEHWAITLGKPPQGAPAFPHWVIERSKVLHQPQP* |
Ga0075030_1001476661 | 3300006162 | Watersheds | PDTYVGEGGTGWVDHWAITMGKPPMGSPVFPQWVIDRSKALHQPQP* |
Ga0070716_1002142771 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GEEGTGWLDHWAIAMGKPPQGAPAFPQWVIDRAKTLHQPQP* |
Ga0068871_1017512942 | 3300006358 | Miscanthus Rhizosphere | DTYVGEEGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP* |
Ga0066653_105252252 | 3300006791 | Soil | DDYIGEEGTGWLDHWAITRGQPPQNAPVFPQWVIDRSKALPPHPQP* |
Ga0066665_110302503 | 3300006796 | Soil | PDMYVGEEGTGWFDHWAITMGKPPQGAPAFPQWVIDRSKALQLPQGIVPVAPPPQ* |
Ga0066659_119092322 | 3300006797 | Soil | GEEGTGWIDHWAITRGRPPLNTPVFPQWVIDRSNALPHRPTQP* |
Ga0075425_1007250311 | 3300006854 | Populus Rhizosphere | VGEEGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP* |
Ga0066710_1015397442 | 3300009012 | Grasslands Soil | ALSDQAYGLPDTFIGEEGSGWLDHWAITLGKPPQGAPSVPQWVNERWKVLRSPQP |
Ga0099830_109166422 | 3300009088 | Vadose Zone Soil | LPDTFVGEEGSGWIDHWAVTLGKPPQGAPVFPQWVIDRSKALHLPQP* |
Ga0099830_111989941 | 3300009088 | Vadose Zone Soil | GTGWLDHWAITMGKPPQGSPRFPAWVDERYKVLPLPQQPQQPH* |
Ga0105245_101757353 | 3300009098 | Miscanthus Rhizosphere | DQAYGLPDTYVGEEGTGWLDHWAIALGKPPQGAPVFPQWVIDRSKVLHLPQP* |
Ga0105247_100192345 | 3300009101 | Switchgrass Rhizosphere | GWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP* |
Ga0105247_115951561 | 3300009101 | Switchgrass Rhizosphere | GMPDSYVGEEGTGWIDHWAVTQGKPPQGMPIFPQWVIDRSRALHQPQP* |
Ga0066709_1005319381 | 3300009137 | Grasslands Soil | DTFIGEEGSGWLDHWAITLGKPPQGAPSVPQWVNERWKVLRTPQP* |
Ga0105243_124647572 | 3300009148 | Miscanthus Rhizosphere | AYGLPDTYVGEEGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP* |
Ga0105241_112198451 | 3300009174 | Corn Rhizosphere | EEGTGWLDHWAVSLGKPPQNAPVFPQWVIERSKNLALPQP* |
Ga0105242_100075848 | 3300009176 | Miscanthus Rhizosphere | LPDTYVGEEGTGWLDHWAIAQGKPPRGAPVFPQWVIDRSKALKLPQP* |
Ga0105242_110513862 | 3300009176 | Miscanthus Rhizosphere | VGEEGTGWLDHWAIALGKPPQGAPVFPQWVIDRSKVLHLPQP* |
Ga0105238_102650301 | 3300009551 | Corn Rhizosphere | LNDSAYALPDTYVGEEGTGWLDHWAIAQGKPPRGAPVFPQWVIDRSKALKLPQP* |
Ga0116224_105361401 | 3300009683 | Peatlands Soil | EEGAGWLDHWAITQGKPPQGAPVFPQWVIDRSKPLHQPQP* |
Ga0126373_123740832 | 3300010048 | Tropical Forest Soil | WLDHWAITMGKPPQGEPVFPQWVIDLAKPLRQPQP* |
Ga0134063_102762013 | 3300010335 | Grasslands Soil | DALSDQAYGLPDTFVGEEGTGWLDHWAIALGKPPQGSPTVPQWVNERWKVLRAPQP* |
Ga0134071_101664101 | 3300010336 | Grasslands Soil | QAYGLPDTFIGEEGTGWLDHWAITLGKPPRGGAPSVPQWVNERWKVLRSPQP* |
Ga0074044_111470431 | 3300010343 | Bog Forest Soil | DTFVAEEGTGWIDHWAITLGHPPQGAPVFPQWVMDRSKALHQPQP* |
Ga0126370_108835792 | 3300010358 | Tropical Forest Soil | WLDHWAITMGKPPQGAPEFPKWVIDRAQSLHKPQP* |
Ga0134066_104588382 | 3300010364 | Grasslands Soil | GEGGTGWLEHWAITQGKIPQGAPVFPQAVFEKWKALWATQP* |
Ga0126379_126572392 | 3300010366 | Tropical Forest Soil | GWLDHWAITMGKPPQGEPVFPQWVIDLAKPLRQPQP* |
Ga0105239_128842131 | 3300010375 | Corn Rhizosphere | GTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP* |
Ga0134126_123323752 | 3300010396 | Terrestrial Soil | QAYGLPDTYVGEEGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP* |
Ga0134121_116409081 | 3300010401 | Terrestrial Soil | EEGTGWLDHWAITLGKPPQGAPVFPQWVIDRSKLLHLPQP* |
Ga0137392_107058392 | 3300011269 | Vadose Zone Soil | EEGTGWLEHWAITMGKPPQGSPRFPAWVDERYKVLPLPQQPQQPH* |
Ga0137392_109023322 | 3300011269 | Vadose Zone Soil | DEYVGEEGTNWLDHWAVTRGQPPQGVPEFPSDMLDKSKALARTPPLQ* |
Ga0137391_115779972 | 3300011270 | Vadose Zone Soil | YSLPDEYVGEEGTNWLDHWAVTRGQPPQGVPEFPPDMLERSKALPRTPPLQ* |
Ga0137365_107911871 | 3300012201 | Vadose Zone Soil | YIGEEGTAWIDHWAITRGRPPLNTPVFPQWVIDRSNALPHRPTQP* |
Ga0137362_112493022 | 3300012205 | Vadose Zone Soil | VGEEGTGWLDHWAIAMGKPPQGAPVFPQWVIDRAKTLHQAQP* |
Ga0137376_100408445 | 3300012208 | Vadose Zone Soil | AYGLPDTYVGEGTGWLDHWGITQGKPPQGAPVFPQWVIDRSHALGR* |
Ga0137386_105396771 | 3300012351 | Vadose Zone Soil | DHWAITRGQPPQNAPVFPQWVIDRSKALPPHPQP* |
Ga0137384_106662741 | 3300012357 | Vadose Zone Soil | HWAITRGRPPLNTPVFPQWVIDRSNALPHRPTQP* |
Ga0137384_109834702 | 3300012357 | Vadose Zone Soil | GTGWMEHWAITQGKIPQGAPVFPQGVIEKWKALAPTQP* |
Ga0137360_107198911 | 3300012361 | Vadose Zone Soil | GTGWIEHWAITQGKIPQGAPVFPQAVIEKWKALAPTQP* |
Ga0137361_110336042 | 3300012362 | Vadose Zone Soil | EEGTGWIEHWAITQGKIPQGAPVFPQAVIEKWKALAPTQP* |
Ga0137396_109356601 | 3300012918 | Vadose Zone Soil | EGTGWLDHWAITMGKPPQGSPRFPAWVDERCKVLPLPQQPQQPH* |
Ga0137416_106275251 | 3300012927 | Vadose Zone Soil | LSDQAYGLPDTYVGEEGSGWLDHWAISLGKPPQGAPVFPQWVIDRSKALHLPQP* |
Ga0137404_106150081 | 3300012929 | Vadose Zone Soil | LDHWAISLGKPPQGAPVFPQWVIDRSKALHLPQP* |
Ga0157376_103235952 | 3300014969 | Miscanthus Rhizosphere | GAGWLEHWAITQGKPPQGAPIFPQWVIDRNRALPRTQP* |
Ga0132256_1002883121 | 3300015372 | Arabidopsis Rhizosphere | EEGTGWLDHWAIAQGKPPQGAPVFPQWVIDRARPLRQPQP* |
Ga0187776_102047071 | 3300017966 | Tropical Peatland | QEGTGWIDHWAVTMGKPPQGAPVFPQWVIDRSKPLHAPQP |
Ga0184605_104508631 | 3300018027 | Groundwater Sediment | ALGDEAYGLPDTYVGEGTGWLDHWGITQGKPPQGAPVFPQWVIDRSHALGR |
Ga0187890_102916012 | 3300018044 | Peatland | DEYVGEEGAGWLEHWAITRGRPPLNAPVFPQWVIDRDKALPHGPPEEPIF |
Ga0066669_119309861 | 3300018482 | Grasslands Soil | LPDTFVGEGGRGWLDHWAITIGKPPQGAPVFPQWVIDRSKALSPPQMQVPQ |
Ga0137408_10862061 | 3300019789 | Vadose Zone Soil | SEKEEGTGWLDHWAITRGQPPQNAPVFPQWVIDRSKSLPPHPQP |
Ga0193723_10280452 | 3300019879 | Soil | EEGTGWLEHWAITMGKPPQGAPEFPQWVIDRAKPLHQPQP |
Ga0193755_10084712 | 3300020004 | Soil | YVGEEGTGWLEHWAITMGKPPQGAPEFPQWVIDRAKPLHQPQP |
Ga0193724_10579631 | 3300020062 | Soil | GEEGTGWIDHWAITLGKPPQGAPVFPQWVIDRSKALGQPQP |
Ga0247680_10408172 | 3300024246 | Soil | LPDTYVGEEGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP |
Ga0207656_105314423 | 3300025321 | Corn Rhizosphere | GLPDTYVGEEGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP |
Ga0207684_109618382 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | WIDHWAITRGHPPQNTPVFPQWVIDRSNALRPQQTQP |
Ga0207671_113202001 | 3300025914 | Corn Rhizosphere | PDTYVGEEGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP |
Ga0207652_101620941 | 3300025921 | Corn Rhizosphere | GEEGSNWLDHWAITQGHPPINTPVFPQWVIDRSKALPHRPTQP |
Ga0207664_112193702 | 3300025929 | Agricultural Soil | WIDHWAITRGHPPQNTPVFPQWVIDLSNALPHRPTQP |
Ga0207704_112690212 | 3300025938 | Miscanthus Rhizosphere | ALPDTYVGEEGTGWLDHWAIAQGKPPRGAPVFPQWVIDRSKALKLPQP |
Ga0207668_121616732 | 3300025972 | Switchgrass Rhizosphere | GEEGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP |
Ga0207676_103870111 | 3300026095 | Switchgrass Rhizosphere | GWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP |
Ga0209236_11572122 | 3300026298 | Grasslands Soil | GWMEHWAITQGKIPQGAPVFPQGVIEKWKALAPTQP |
Ga0209804_13279902 | 3300026335 | Soil | PDDYIGEEGTGWLDHWAITRGQPPQNAPVFPQWVIDRSKALPPHPQP |
Ga0209056_103619381 | 3300026538 | Soil | SDQAYGLPDTFIGEEGSGWLDHWAITLGKPPQGAPSVPQWVNERWKVLRTPQP |
Ga0209056_103792431 | 3300026538 | Soil | TGWLDHWAITRGKPPQGAPEFPAWVIEKSRAIQKPPP |
Ga0209325_10177871 | 3300027050 | Forest Soil | YVGEEGTGWLDHWAIAMGKPPQGAPVFPQWVIDRAKVLHQPQP |
Ga0208241_10368942 | 3300027297 | Forest Soil | EEGSGWIEHWAIAQGHPPQGAPVFPQWVIDRSKALHQPQP |
Ga0209656_101037921 | 3300027812 | Bog Forest Soil | GEEGTSWLDHWAITRGHPPQNAPVFPQWVIDRANALPKGQPELPLFQ |
Ga0209590_108535882 | 3300027882 | Vadose Zone Soil | AYSLPDEYVGEEGTNWLDHWAVTRGQPPQGVPEFPSDMLDKSKALARTPPLQ |
Ga0257175_10182001 | 3300028673 | Soil | QAYSLPDTFVGEEGTGWIDHWAITLGKPPQGSPVFPQWVIDRSKALKLPQP |
Ga0307312_108718212 | 3300028828 | Soil | GWIDHWAITLGKPPQGSPVFPQWVIDRSKALKLPQP |
Ga0170820_113240802 | 3300031446 | Forest Soil | PDEYVGEEGTNWIDHWAITRGHPPQNTPVFPQWVIDRSNALHSSAAQPAY |
Ga0170820_122721481 | 3300031446 | Forest Soil | WIDHWAITRGHPPQNTPVFPQWVIDRSNALRPPQTQP |
Ga0310915_100279981 | 3300031573 | Soil | EEGTGWLDHWAITRGRPPQNTPVFPQWVIDRSKALPRPPPETPIF |
Ga0318550_105403952 | 3300031797 | Soil | DEYVGEEGTGWLDHWAITRGRPPQNTPVFPQWVIDRSKALPRPPPETPIF |
Ga0307473_114792761 | 3300031820 | Hardwood Forest Soil | GEEGTGWLDHWAITMGKPPQGAPEFPQWVIDRAKALHHPQP |
Ga0307478_114953991 | 3300031823 | Hardwood Forest Soil | FVGEEGTGWLDHWAITMGKPPQGSPRFPTWVDERYKVLPLPQQPQQPH |
Ga0307472_1009149352 | 3300032205 | Hardwood Forest Soil | PDTFVGEEGTGWIDHWAISQGKPPLGVPVFPQWVIDRSKALHQPQPQAALP |
Ga0335082_107855891 | 3300032782 | Soil | YIGEEGTDWLDHWAITRGKPPQGRPVFPQWVIERSKTIPRPPATVH |
Ga0335077_108128421 | 3300033158 | Soil | SLPDTYVGEEGTGWLDHWAITMGKPPQGAPVFPQWVIDRAKPLRQPQP |
⦗Top⦘ |