Basic Information | |
---|---|
Family ID | F101699 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 41 residues |
Representative Sequence | DGDFEFRRTEYDVPRAAAGYRSMGGDFGEFAARRIERGSD |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 5.88 % |
% of genes from short scaffolds (< 2000 bps) | 5.88 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.62 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (95.098 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.628 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.471 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.902 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.35% β-sheet: 0.00% Coil/Unstructured: 67.65% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF02566 | OsmC | 57.84 |
PF16193 | AAA_assoc_2 | 9.80 |
PF12850 | Metallophos_2 | 7.84 |
PF13442 | Cytochrome_CBB3 | 6.86 |
PF12002 | MgsA_C | 6.86 |
PF00903 | Glyoxalase | 1.96 |
PF01494 | FAD_binding_3 | 0.98 |
PF00149 | Metallophos | 0.98 |
PF03006 | HlyIII | 0.98 |
PF07676 | PD40 | 0.98 |
PF03301 | Trp_dioxygenase | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 57.84 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 57.84 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.96 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.98 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.98 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.98 |
COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.98 |
COG3483 | Tryptophan 2,3-dioxygenase (vermilion) | Amino acid transport and metabolism [E] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 95.10 % |
All Organisms | root | All Organisms | 4.90 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005574|Ga0066694_10429645 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300009177|Ga0105248_12874301 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300017659|Ga0134083_10568300 | Not Available | 515 | Open in IMG/M |
3300031543|Ga0318516_10217760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1104 | Open in IMG/M |
3300031544|Ga0318534_10211910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1118 | Open in IMG/M |
3300032009|Ga0318563_10208722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1053 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.86% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.88% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.90% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.94% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.96% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.96% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.96% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 1.96% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.96% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.98% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.98% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.98% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.98% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
3300025556 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027991 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK24 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4MG_00832310 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | RVRFQRTEYDVERAADGVPAMGGDFGEFAARRIERGSD |
C688J18823_105677713 | 3300001686 | Soil | DGEFEFRRTEYDNERAADAFRELGGRFGEMVAGRILRGSD* |
JGI24738J21930_100833071 | 3300002075 | Corn Rhizosphere | RRTDYDVERAAAAYRQMRGDFGEFAANRIERGSD* |
Ga0062595_1013944201 | 3300004479 | Soil | AVRDDEGRFEFRRTEYDNERSAAAYLALGGGFGEMVARRLERGSD* |
Ga0062594_1001760473 | 3300005093 | Soil | WDGDFEFRRTEYDVARAAAGYRSMGGDFGEFAAGRIERGSD* |
Ga0066677_106348621 | 3300005171 | Soil | WEDDFTFRRTEYDVEAAAAAYRAMGGDFGEFAARRIEKGSD* |
Ga0066679_105590612 | 3300005176 | Soil | GEFEFRRTEYDIERAAAGWRKLGGDFGKFAAERIERGRD* |
Ga0068868_1003779713 | 3300005338 | Miscanthus Rhizosphere | WDGDFEFRRSDYDVARAAEGYRSLGGDFGEFAARRIERGSD* |
Ga0070688_1009641221 | 3300005365 | Switchgrass Rhizosphere | TWDGDFTFRRTEYDAEAAAAAYRSMGGDFGEFAAHRIERGSD* |
Ga0070701_109777671 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | IQDDDGEFAFRRTDYDVERAAAAYRQMRGDFGEFAANRIERGSD* |
Ga0070700_1007838013 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | DDHFTFRRTEYDVERAAEAYRGMGGAFGEFAANRILRGSD* |
Ga0066689_108094772 | 3300005447 | Soil | WDGDFTFRRTEYDFEAAAAAYRAMGGDFAEFAARRIEKGSD* |
Ga0070707_1018452021 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | DGDFTFRRTEYDAEAAAAAYRSMGGDFGEFAARRLERGSD* |
Ga0066694_104296452 | 3300005574 | Soil | AWATWDGDFEFRRTEYDVARAAAGYRSLAGEFGEFAARRIELGSD* |
Ga0070717_101983373 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VRADDGEFAFRRTEYDAQAAADGYRRLGGEFGEFAARRIERGSD* |
Ga0066652_1007815211 | 3300006046 | Soil | WAVRGDDGQFAFRRTEYDVERAATAYRELGGDFGQFAADRILRGSD* |
Ga0070716_1016925131 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | FRRTEYDVERAAAAYRAMGGDFGEFAARRIEKGSD* |
Ga0070712_1017765272 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GAFEFRRCEYDVERAAAGYRSMGGNFGEFAARRIEKGSD* |
Ga0074051_117845141 | 3300006572 | Soil | GELEFRRTEYDVERAADAYRAMSGRFGPLAARRIERGSD* |
Ga0074055_115597662 | 3300006573 | Soil | DGDFEFRRTEYDVPRAAAGYRSMGGDFGEFAARRIERGSD* |
Ga0079222_122927891 | 3300006755 | Agricultural Soil | DFELRRTEYDIQRAADGFRALGGDFAEFAANRIERGSD* |
Ga0066653_100521263 | 3300006791 | Soil | EFRFERTDYDVERAAEAYRSLGGGFGDMAARRIERGSD* |
Ga0075436_1001419844 | 3300006914 | Populus Rhizosphere | WATWNGDFTFRRTDYDFEAAAAAYRAMGGEFGEFAARRLEKGSD* |
Ga0099827_111933293 | 3300009090 | Vadose Zone Soil | WATWDGDFVFRRTEYDVARAAAGYRSLAGEFGEFAARRIERGSD* |
Ga0075418_112887383 | 3300009100 | Populus Rhizosphere | FRRTEYDVERALAGWRAVPGPFGEMVTHRIEHGSD* |
Ga0066709_1002572014 | 3300009137 | Grasslands Soil | WDGDFTFRRTEYDVAPAAAAYRAMGGDFGEFAARRIEKGSD* |
Ga0066709_1004849821 | 3300009137 | Grasslands Soil | DDGEFEFRRTEYDVERAAAAWRKLGGDFGTFAAARIERGSD* |
Ga0066709_1012297663 | 3300009137 | Grasslands Soil | RRTEYAVARAAEGYRSMGGDFGEFAARRIERGSD* |
Ga0105248_128743012 | 3300009177 | Switchgrass Rhizosphere | WATWDGDFQLRRTEYDVARAAEGYRALAGDFGEFAAARIERGSD* |
Ga0105238_109969331 | 3300009551 | Corn Rhizosphere | WDGDFELRRTEYEVARAAAGYRSMGGDFGEFAARRIERGSD* |
Ga0126374_101839581 | 3300009792 | Tropical Forest Soil | DFTFRRTAYNAEPAAAAYRSMGGDFGEFAARRIERGSD* |
Ga0126309_107792652 | 3300010039 | Serpentine Soil | ATWDGDFEFRRTEYDVARAAAGYAGLGGNFGEFAAARIRKGSD* |
Ga0126314_101330533 | 3300010042 | Serpentine Soil | FEFRRTEYDTERAAAEWRVLASPWCEQAAGRIERGSD* |
Ga0126382_115844771 | 3300010047 | Tropical Forest Soil | RRTEYDVQRAADAYRRMGGSFGEFASRRIERGSD* |
Ga0126319_14402053 | 3300010147 | Soil | AVRYDDGQFEFRRTEYDNQRAADAYRKLGGEFGEFAARRLERGSD* |
Ga0134086_100462241 | 3300010323 | Grasslands Soil | RRTAYDLEPAAAAYRAMGGDFGEFAARRIEKGSD* |
Ga0134064_103449901 | 3300010325 | Grasslands Soil | FEFRRTEYDVERAAAAYRAMGGEFGEFAARRIERGSD* |
Ga0134065_101709631 | 3300010326 | Grasslands Soil | WATWEGDFAFRRTAYDVEAPAAAYRAMGGDFGEFAARRIEKGSD* |
Ga0134080_104322413 | 3300010333 | Grasslands Soil | FERTEYDVQRAADAYRSMGGGFGDMAAGRIERGSD* |
Ga0126376_111647113 | 3300010359 | Tropical Forest Soil | VRTPEGDLEFRRTEYDVERAAEAYEALGGRFGRFMGRRIRRGSD* |
Ga0105239_101861184 | 3300010375 | Corn Rhizosphere | WATVEGDFVLRRTEYDVRRAADAYRALGGRFGEFMGRRIERGSD* |
Ga0150985_1143422561 | 3300012212 | Avena Fatua Rhizosphere | GEFEFRRTEYDNERAAAAFRELGGNFGEMVAGRIERGSD* |
Ga0150985_1177056443 | 3300012212 | Avena Fatua Rhizosphere | DGAFGLRRTEYDVQRAADAYRALGGGFGEMVANRIEKGSD* |
Ga0150984_1016503422 | 3300012469 | Avena Fatua Rhizosphere | AVRTEGEFAFRRTTYDVERAVDGFRRLGGGFGAMVVRRLERGSD* |
Ga0150984_1228665731 | 3300012469 | Avena Fatua Rhizosphere | ATWDSDFAFRRTDYDVARAADGYRVMGGNFGEMASRRIERGSD* |
Ga0157314_10490301 | 3300012500 | Arabidopsis Rhizosphere | RRTEYDVERAAAGYRSLDGDIAEFAASRIERGSD* |
Ga0157282_100024754 | 3300012904 | Soil | AWATVEGDFVLRRTEYDVRRAADAYRALGGRFGEFMGRRIERGSD* |
Ga0164300_103354241 | 3300012951 | Soil | TWNGDFAFRRTEYDVERAAATYRAMGGDFAEFAARRIEKGSD* |
Ga0164300_106630942 | 3300012951 | Soil | FRRTEYDNQRAADAYRKLGGEFGEFAARRLERGSD* |
Ga0164309_111526373 | 3300012984 | Soil | DFEFRRTEYDVARAAAGYRSMGGEFGEFAATRIERGSD* |
Ga0134089_103150041 | 3300015358 | Grasslands Soil | PQPGEFEFRRCEYDVERAADGYRRMGGDFGEMAAGRIERGSD* |
Ga0132258_115802994 | 3300015371 | Arabidopsis Rhizosphere | DGDFELRRTGYDVARAAAGYRSLGGDFGEFAARRIERGSD* |
Ga0132257_1025631392 | 3300015373 | Arabidopsis Rhizosphere | WDGDFEFRRTEYDVARAAAGYRSMGGDFGEFAARRIERGSD* |
Ga0134083_105683001 | 3300017659 | Grasslands Soil | AAWATWAGDFEFRRTEYDVQRAADGYRAMGGDFGEFAATRIERGSD |
Ga0184608_103183282 | 3300018028 | Groundwater Sediment | EFHRTAYDVARAAAGYRSMGGEFGEFASRRIERGSD |
Ga0184619_100857461 | 3300018061 | Groundwater Sediment | GEFEFRRTEYDVEQAAAGYRSMGGEFGEFAARRIERGSD |
Ga0184640_103642132 | 3300018074 | Groundwater Sediment | DFTFRRVEYDWQRAAAGFRRMGGDFGEFAAVRIERGSD |
Ga0066655_107562312 | 3300018431 | Grasslands Soil | RPGEFWFERTDYDVERAAEAYRLMGGQFGEFAARRIERGSD |
Ga0066669_108553641 | 3300018482 | Grasslands Soil | SAEPGEFEFRRCEYDVERAADGYRRMGGDFGEFAARRIERGSD |
Ga0173482_100900691 | 3300019361 | Soil | TFDDDDFTFRRTEYDTQRAADAYRAMGGAFGEMAGNRIERGSD |
Ga0210382_104546292 | 3300021080 | Groundwater Sediment | VRTDGGEFEFRRTEYDVEKAAAGYRSMGGEFGEFAARRIERGSD |
Ga0210382_105283831 | 3300021080 | Groundwater Sediment | WDGDFDFRRTDYDVARAAAGYRSLAGDFGEFAARRIEKGSD |
Ga0222622_102290201 | 3300022756 | Groundwater Sediment | WATRDGDFEFRRTEYDVARAAAGYRSMGGDFGEFAANRIERGSD |
Ga0247795_10145181 | 3300022899 | Soil | TVEGDFVLRRTEYDVRRAADAYRALGGRFGEFMGRRIERGSD |
Ga0247790_101151941 | 3300022915 | Soil | DFILRRTEYDVRRAADAYRALGGRFGEFMGRRIERGSD |
Ga0247664_11129621 | 3300024232 | Soil | WAVRRDDGDFEFRRAEYDVERAAAGWRTLGSDFGELAARRVERGRD |
Ga0210120_11192352 | 3300025556 | Natural And Restored Wetlands | AFEFRRTEYDNQRAAAAYRELAGDFGAMAAGRILRGSD |
Ga0207687_106093543 | 3300025927 | Miscanthus Rhizosphere | FRRTEYDVARAAAGYRSMGGDFSEFAARRIERGSD |
Ga0207700_101805143 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | SAWATFDDHFTFRRTEYDVERAAEAYRGMGGAFGEFAANRILRGSD |
Ga0207691_111882611 | 3300025940 | Miscanthus Rhizosphere | ADDGEFAFRRTEYDAQAAADGYRRLGGEFGEFAARRIERGSD |
Ga0207689_101717953 | 3300025942 | Miscanthus Rhizosphere | AVRDDEGRFEFRRTEYDNERSAAAYLALGGGFGEMVARRLERGSD |
Ga0207667_115758572 | 3300025949 | Corn Rhizosphere | DGQFEFRRTSYDNERAAHAYRKLGGEFGEFAARRIERGSD |
Ga0207648_116593312 | 3300026089 | Miscanthus Rhizosphere | FRRTDYDVERAAAAYRQMRGDFGEFAANRIERGSD |
Ga0209687_10326354 | 3300026322 | Soil | WATWDGDFTFRRTEYDVEPAAAAYRAMGGDFGEFAARRIEKGSD |
Ga0209267_13153481 | 3300026331 | Soil | QPGEFEFRRCEYDVERAAEAYRAMGGDFGAFAARRIERGSD |
Ga0209803_12724221 | 3300026332 | Soil | WDGDFTFRRTEYDFEAAAAAYRAMGGDFAEFAARRIEKGSD |
Ga0209159_12354601 | 3300026343 | Soil | AVSERPGEFLFERTDYDVERAAEAYRLMGGQFGEFAARRIERGSD |
Ga0209795_101213991 | 3300027718 | Agave | LEDGEFAFRRTEYDVERAAEAYRRMGGAFGEMAAARIEKGSD |
Ga0247683_10041571 | 3300027991 | Soil | TFRRTEYDVERAAEAYRGMGGAFGEFAANRILRGSD |
Ga0307313_102301971 | 3300028715 | Soil | EFRRTEYDVEKAAAGYRSMGGEFGEFAARRIVRGSD |
Ga0307301_101602712 | 3300028719 | Soil | RTDDGEFQFRRTEYDADSAAAAYRRMGGGFGEMAAKRIEKGSD |
Ga0307301_101884483 | 3300028719 | Soil | TWDGDFEFRRTDYDVARAAEGYRSMGGDFGEFAARRIERGSD |
Ga0307317_100232411 | 3300028720 | Soil | WAIQDYDGEFAFRRTQYDVERTAAAYRQMPGDFGEFAANRIERGSD |
Ga0307315_102915441 | 3300028721 | Soil | DDGVFEFRRTAYDNQRAADAYRKLGGDFGEFAARRLERGSD |
Ga0307318_102437531 | 3300028744 | Soil | WAVRTDDGEFQFRRTEYDADSAAEAYRRMGGGFGEMAARRIEKGSD |
Ga0307280_101980771 | 3300028768 | Soil | TRDGDFEFRRTEYDVARAAAGYRSMGGDFGEFAANRIEKGSD |
Ga0307320_100517081 | 3300028771 | Soil | TWDYDFTFRRTEYDVERAAAAYCALGGAFGEMAARRIEHGSD |
Ga0307305_100720583 | 3300028807 | Soil | AVRTDDGEFQFRRTEYDADSAAAAYRRMGGGFGEMAAKRIEKGSD |
Ga0307310_101635451 | 3300028824 | Soil | DDGEFQFRRTEYDADSAAEAYRRMGGGFGEMAARRIEKGSD |
Ga0307312_104869823 | 3300028828 | Soil | DFEFRRTEYDVARAAEGYRSMGGDFGEFAARRIERGSD |
Ga0307300_100147301 | 3300028880 | Soil | TWEGDFAFRRTEYDVERAAAAYRSLGGPFGEMAANRILKGSD |
Ga0307277_100239981 | 3300028881 | Soil | FDFRRSAYDVARAAAGYRSMSGEFGQFAAGRIERGSD |
Ga0247826_102514541 | 3300030336 | Soil | EGDFVLRRTEYDVRRAAEAYRALGGRFGEFMGRRIERGSD |
Ga0247826_107167301 | 3300030336 | Soil | FEFRRTDYDTERAAAGFRTMGGELAEWAANRILRGSD |
Ga0308204_102385922 | 3300031092 | Soil | FAFRRTEYDVERAAAAYRQMRGDFGKFAANRIERGSD |
Ga0318516_102177603 | 3300031543 | Soil | RDDGEFEFRRTEYDVARAIEGWRRLGAGFPELAARRLELGRD |
Ga0318534_102119101 | 3300031544 | Soil | WAVRRDDGEFEFRRTEYDVARAIEGWRRLGAGFPELAARRLELGRD |
Ga0318563_102087223 | 3300032009 | Soil | DDGEFEFRRTEYDVARAIEGWRRLGAGFPELAARRLELGRD |
Ga0307471_1032127101 | 3300032180 | Hardwood Forest Soil | DGHLTFRRTEYDVERAAEAYRGMGGAFGEFAANRILRGSD |
Ga0334913_088871_505_639 | 3300034172 | Sub-Biocrust Soil | VRADDGELVFRRTEYDVERAVDAYRRMGGDFGGMAARRLERGSD |
Ga0373948_0135566_479_604 | 3300034817 | Rhizosphere Soil | FDGHFTFRRTEYDVERAAEAYRGMGGAFGEFAANRILRGSD |
Ga0373950_0001343_3070_3189 | 3300034818 | Rhizosphere Soil | GDFTLRRTEYDAEAAAAAYRSMGGDFGEFAARRLERGSD |
⦗Top⦘ |