NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101613

Metagenome / Metatranscriptome Family F101613

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101613
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 43 residues
Representative Sequence MARKTGPTISQEECYPLADEPVREELDDARLLDLDVEQESPFLR
Number of Associated Samples 95
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 36.63 %
% of genes near scaffold ends (potentially truncated) 98.04 %
% of genes from short scaffolds (< 2000 bps) 89.22 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.784 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(12.745 % of family members)
Environment Ontology (ENVO) Unclassified
(26.471 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.22%    β-sheet: 0.00%    Coil/Unstructured: 77.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF02875Mur_ligase_C 9.80
PF12867DinB_2 7.84
PF08245Mur_ligase_M 6.86
PF01098FTSW_RODA_SPOVE 1.96
PF01839FG-GAP 0.98
PF08922DUF1905 0.98
PF01988VIT1 0.98
PF01381HTH_3 0.98
PF04101Glyco_tran_28_C 0.98
PF00293NUDIX 0.98
PF00563EAL 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0772Peptodoglycan polymerase FtsW/RodA/SpoVECell cycle control, cell division, chromosome partitioning [D] 1.96
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 0.98
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 0.98
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 0.98
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 0.98
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 0.98
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.78 %
UnclassifiedrootN/A39.22 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001915|JGI24741J21665_1051852All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300002558|JGI25385J37094_10059046All Organisms → cellular organisms → Bacteria1260Open in IMG/M
3300004080|Ga0062385_10010182All Organisms → cellular organisms → Bacteria3171Open in IMG/M
3300004633|Ga0066395_10553313Not Available669Open in IMG/M
3300005174|Ga0066680_10065803All Organisms → cellular organisms → Bacteria2160Open in IMG/M
3300005290|Ga0065712_10508353All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300005328|Ga0070676_11297428Not Available556Open in IMG/M
3300005332|Ga0066388_105030531Not Available672Open in IMG/M
3300005454|Ga0066687_10025101All Organisms → cellular organisms → Bacteria2561Open in IMG/M
3300005456|Ga0070678_101748006All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300005535|Ga0070684_101623106All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae610Open in IMG/M
3300005569|Ga0066705_10314198Not Available992Open in IMG/M
3300005578|Ga0068854_101886715Not Available549Open in IMG/M
3300005586|Ga0066691_10698184All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300005586|Ga0066691_10919645All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300005598|Ga0066706_10137926All Organisms → cellular organisms → Bacteria1821Open in IMG/M
3300005718|Ga0068866_10057050Not Available2010Open in IMG/M
3300005834|Ga0068851_10674984Not Available634Open in IMG/M
3300006031|Ga0066651_10716486Not Available538Open in IMG/M
3300006047|Ga0075024_100657181Not Available570Open in IMG/M
3300006050|Ga0075028_100383780All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300006052|Ga0075029_100233486All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1157Open in IMG/M
3300006052|Ga0075029_100477985Not Available820Open in IMG/M
3300006102|Ga0075015_100825386Not Available558Open in IMG/M
3300006162|Ga0075030_101344798Not Available560Open in IMG/M
3300006175|Ga0070712_101311867Not Available631Open in IMG/M
3300006176|Ga0070765_100021534All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4835Open in IMG/M
3300009089|Ga0099828_11302463Not Available643Open in IMG/M
3300009093|Ga0105240_11769744All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300009148|Ga0105243_12122171All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300009176|Ga0105242_10089957Not Available2581Open in IMG/M
3300010301|Ga0134070_10223183All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium697Open in IMG/M
3300010337|Ga0134062_10100501All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1241Open in IMG/M
3300010360|Ga0126372_12793316All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300010366|Ga0126379_10229708All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1810Open in IMG/M
3300010397|Ga0134124_12745571Not Available536Open in IMG/M
3300011119|Ga0105246_10484744Not Available1047Open in IMG/M
3300012198|Ga0137364_10163724All Organisms → cellular organisms → Bacteria1615Open in IMG/M
3300012199|Ga0137383_10841945All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium670Open in IMG/M
3300012353|Ga0137367_10679121All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium718Open in IMG/M
3300012363|Ga0137390_10461646All Organisms → cellular organisms → Bacteria1245Open in IMG/M
3300012917|Ga0137395_10863804All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300012924|Ga0137413_10492436Not Available900Open in IMG/M
3300012929|Ga0137404_11079716Not Available736Open in IMG/M
3300012951|Ga0164300_11025312Not Available533Open in IMG/M
3300012988|Ga0164306_11986148Not Available506Open in IMG/M
3300013306|Ga0163162_10719243All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300013308|Ga0157375_11205101Not Available888Open in IMG/M
3300014838|Ga0182030_11278617Not Available620Open in IMG/M
3300014968|Ga0157379_11779097Not Available605Open in IMG/M
3300015241|Ga0137418_10838567All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300017823|Ga0187818_10216927All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300017943|Ga0187819_10490524Not Available701Open in IMG/M
3300017973|Ga0187780_10312245All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1106Open in IMG/M
3300017974|Ga0187777_10520147All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium833Open in IMG/M
3300017975|Ga0187782_11237463Not Available585Open in IMG/M
3300017999|Ga0187767_10241166Not Available591Open in IMG/M
3300017999|Ga0187767_10339599All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300018047|Ga0187859_10826274All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300018061|Ga0184619_10066953All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1582Open in IMG/M
3300018482|Ga0066669_10008145All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5122Open in IMG/M
3300020583|Ga0210401_10269401Not Available1563Open in IMG/M
3300021171|Ga0210405_10193051All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1614Open in IMG/M
3300021180|Ga0210396_11009500All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300021404|Ga0210389_11178076Not Available590Open in IMG/M
3300021404|Ga0210389_11408155Not Available532Open in IMG/M
3300021432|Ga0210384_10991881All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300021477|Ga0210398_10624723All Organisms → cellular organisms → Bacteria → Acidobacteria874Open in IMG/M
3300021477|Ga0210398_11110190Not Available628Open in IMG/M
3300022557|Ga0212123_10685334All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300022726|Ga0242654_10083245All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300025625|Ga0208219_1125681All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium570Open in IMG/M
3300025922|Ga0207646_11019256All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium731Open in IMG/M
3300025929|Ga0207664_10639990All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium955Open in IMG/M
3300026298|Ga0209236_1238967All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300026306|Ga0209468_1106954All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium881Open in IMG/M
3300026315|Ga0209686_1006331All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5141Open in IMG/M
3300026323|Ga0209472_1100039All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1157Open in IMG/M
3300026324|Ga0209470_1157464All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium994Open in IMG/M
3300026333|Ga0209158_1300016All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300026334|Ga0209377_1232423All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300026527|Ga0209059_1144965All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium872Open in IMG/M
3300027641|Ga0208827_1040996All Organisms → cellular organisms → Bacteria1597Open in IMG/M
3300027874|Ga0209465_10161321All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1115Open in IMG/M
3300027908|Ga0209006_11102035Not Available626Open in IMG/M
3300028906|Ga0308309_10208632All Organisms → cellular organisms → Bacteria1614Open in IMG/M
3300030659|Ga0316363_10321212All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300031720|Ga0307469_11277480Not Available696Open in IMG/M
3300031740|Ga0307468_100050752Not Available2164Open in IMG/M
3300031740|Ga0307468_102409353Not Available514Open in IMG/M
3300031820|Ga0307473_11092659All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300031823|Ga0307478_10050019Not Available3097Open in IMG/M
3300031954|Ga0306926_12699876Not Available539Open in IMG/M
3300032180|Ga0307471_100703403All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300032205|Ga0307472_100789433Not Available866Open in IMG/M
3300032783|Ga0335079_11786298All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300032805|Ga0335078_10585775All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300032805|Ga0335078_11259210All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300032828|Ga0335080_10597556All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300032897|Ga0335071_11614863Not Available593Open in IMG/M
3300033158|Ga0335077_10639377All Organisms → cellular organisms → Bacteria1104Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.80%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.82%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.86%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds5.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.88%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.94%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.96%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.98%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.98%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.98%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.98%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.98%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.98%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.98%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001915Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7Host-AssociatedOpen in IMG/M
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24741J21665_105185223300001915Corn RhizosphereMARKNGPTILQEELYPPPSAGPREEVEDARLLDLEAEQESPFLRGQK
JGI25385J37094_1005904613300002558Grasslands SoilMARKTPTISQEELYLQPDEPVREELDDARLLDLDAEEESPFL
Ga0062385_1001018213300004080Bog Forest SoilMARKFGSTISQEELYPPPDERVREEMDDARLLDLDAEQESPFLRGQKR
Ga0066395_1055331313300004633Tropical Forest SoilMARKSSPTIVQEELYPPPGEPEREVLDDARLLDLDVEEES
Ga0066680_1006580313300005174SoilMARKSSPTISQDELYPPSEEFAREEIEDARLLDLDVEQESPFL
Ga0065712_1050835313300005290Miscanthus RhizosphereMARKGSPTISQEELYPPGEEFVRPALDDTRGLDLDVEEESPFLRA
Ga0070676_1129742823300005328Miscanthus RhizosphereMARKSGPTISQEELYPLADEPGREEAQDARLLDLDVEQEA
Ga0066388_10503053123300005332Tropical Forest SoilMARKNGPSILQEELYPPPAPPVREEIDDTRLVDLDVEQESPFLRGQK
Ga0066687_1002510113300005454SoilMARKSSPTISQEELYPPGEESVRPDVDDARVLDLEAEEESPFLRGQ
Ga0070678_10174800633300005456Miscanthus RhizosphereMARKSGPTISQEDLYPLADEPGREDARLLDLDVEQEPPFLRVQKRV
Ga0070684_10162310613300005535Corn RhizosphereMARKNGPSIVQEELYPPPAPPVREEIDDARLLDLDVEQESPFLRGQKRVPV
Ga0066705_1031419823300005569SoilMARKGSPTISQEELYPSGEEFVRPALDDTRGLDLDVEEES
Ga0068854_10188671523300005578Corn RhizosphereMARKSGPTISQEELYPLADEPGREEAQDARLLDLDVEQEAPFLRVQKRV
Ga0066691_1069818423300005586SoilMARKSPTITQDELYPPDEEFARQDIDDARLLDLDVEQESP
Ga0066691_1091964513300005586SoilMARKTPTISQEELYLQPDEPVREELDDARLLDLDAEEE
Ga0066706_1013792633300005598SoilMARKSPTITQDELYPPDEEFARQDIDDARLLDLDVEQESPFLRAQ
Ga0068866_1005705033300005718Miscanthus RhizosphereMARKSGPTISQEDLYPLADEPGREDSRLLDLDVEQEPPFLRVQK
Ga0068851_1067498423300005834Corn RhizosphereMARKSGPTISQEELYPLADEPGREEAQDARLLDLDVEQEAPFL
Ga0066651_1071648623300006031SoilMARKNAPTISQEELYPQSDEPTRQDLDDARLLDLDAEQESP
Ga0075024_10065718113300006047WatershedsMARKSSPTIVQEELYPSADESVRPNLDDARMLDLDGEEESPFLRGQKR
Ga0075028_10038378023300006050WatershedsMARKSGSTISQEELYPAAHEPARPVPDDGLDDARLLDLDVEQESPFL
Ga0075029_10023348613300006052WatershedsMARKSGSTILQEELYPQTNEPAREEVDDARLLDLDVEQESPFLRGQKRVS
Ga0075029_10047798523300006052WatershedsMARKASPTIEQEELPYASESVREDFDDPRRVDLDVEEESPFLRAQK
Ga0075015_10082538623300006102WatershedsMARKNGPTISQEELYPLADEPGREEVHDARLLDLDVEQEPPFLR
Ga0075030_10134479813300006162WatershedsMARKSSSTILQEELYPQTREPEREEVDDARLPELDVEQESP
Ga0070712_10131186723300006175Corn, Switchgrass And Miscanthus RhizosphereMARKSGPTISQEGLYPLAEEPGREEVNDARLLDLDVEQEPPFLRVQ
Ga0070765_10002153413300006176SoilMARKSGSTISQEELYPPPDEPVREEVDDPRLFELDGDEEAPF
Ga0099828_1130246313300009089Vadose Zone SoilMARKTPTISQEELYLQPDEPVREELDDARLLDLDAEEESPFLRGQKRVS
Ga0105240_1176974423300009093Corn RhizosphereMARKNGPSIVQEELYPPPAPPVREEIDDARLLDLDVEQESPFLRGQKRV
Ga0105243_1212217113300009148Miscanthus RhizosphereMARKNGPTILQEELYPPPSAGPREELEDARLLDLEAEQESPFLRGQK
Ga0105242_1008995713300009176Miscanthus RhizosphereMARKSGPTISQEELYPLADEPGREEAHDARLLDLDVEQEPPFLRVQKRVS
Ga0134070_1022318323300010301Grasslands SoilMARKTPTISQEELYLQPDEPVREELDDARLLDLDAEEES
Ga0134062_1010050133300010337Grasslands SoilMARKTPTISQEESYLQPDEPVREELDDARLLDLDAEEESPFL
Ga0126372_1279331623300010360Tropical Forest SoilMARKTPTISQEELYLQPDEPVREDIDDARLLDLDAEE
Ga0126379_1022970833300010366Tropical Forest SoilMARKSSPTISQEELYSAGEEPVRPDLDDARTLDLDVEEESPFLRAQK
Ga0134124_1274557113300010397Terrestrial SoilMARKSGPTISQEELYPPSEEALRPDLDDARVLDLDVEEESPFLRG
Ga0105246_1048474433300011119Miscanthus RhizosphereMARKSGPTISQEELYPLADEPGREEAQDARLLDLDVEQEAPFLRVQK
Ga0137364_1016372413300012198Vadose Zone SoilMARKNGPSILQEELYPPPDQPVREEMDDARLLDLDVEQESP
Ga0137383_1084194523300012199Vadose Zone SoilMARKNGPSILQEELYPPPDQPVREEMDDARLLDLDVEQES
Ga0137367_1067912123300012353Vadose Zone SoilMARKSGPTIPQEELYPSPDEPTRDDLDDARMLDLDVEQESPFLRG
Ga0137390_1046164613300012363Vadose Zone SoilMARKSSPTISQDELYPPSEEFAREDIEDARLLDLDVEQES
Ga0137395_1086380413300012917Vadose Zone SoilMARKNAPTISQEELYPQSDEPTRQDLDDARLLDLDAEQESPFLRGQ
Ga0137413_1049243623300012924Vadose Zone SoilMARKSGHTISQEELYPLADEPGREEVQDARLLDLDVEQEPP
Ga0137404_1107971613300012929Vadose Zone SoilMARKSGPTISQEELYPQTNEPGRDEAHDARMLDLDVEQEPPF
Ga0164300_1102531213300012951SoilMARKHAPTISQEELYPPPEEATREERDDARMLELDAEQ
Ga0164306_1198614823300012988SoilMARKSGPSIQQEELYPPSDEQALEGLDDSRLVDLDVEQESPF
Ga0163162_1071924313300013306Switchgrass RhizosphereMARKSGPTISQEELYPLADEPGREEAQDARLLDLD
Ga0157375_1120510123300013308Miscanthus RhizosphereMARKSGPTISQEDLYPLADEPGREEAHDARLLDLDVEQEPP
Ga0182030_1127861723300014838BogMARKSGSTILQEELYPQADEPAREEVEDQRLLDLDVEQESP
Ga0157379_1177909713300014968Switchgrass RhizosphereMARKNGPTILQEELYPPPGAAQREEVEDARLLDLEEEQESPFLR
Ga0137418_1083856723300015241Vadose Zone SoilMARKNSSTIVQEELYPLPDGPVREEMDGARLLDLDVEQESPFLRGQKR
Ga0187818_1021692723300017823Freshwater SedimentMARKGSSTISQGELYPHSDEAVREELDDARLFDLDV
Ga0187819_1049052423300017943Freshwater SedimentMARKGSSTILQEELYPQAQETGREEVDDARLLELDVEQESPF
Ga0187780_1031224513300017973Tropical PeatlandMARKTGSTISQEELYPSASPPARDELDDARLVDLDVEDESPFLRGQKRV
Ga0187777_1052014723300017974Tropical PeatlandMARKTGSTISQEELYPSASPPARDELDDARLVDLDVEDESPFLRGQK
Ga0187782_1123746323300017975Tropical PeatlandMARKESPTILQEELYPPPDESAREDPGHVRSLDLDVEEESPFLRRQRRIP
Ga0187767_1024116623300017999Tropical PeatlandMARKASSTISQEELYPQTDEPVREALDDARLLDLDVEE
Ga0187767_1033959923300017999Tropical PeatlandMARKASSTISQEELYPHSDHVRADLDDARLVDLDVEEES
Ga0187859_1082627423300018047PeatlandMARKSGSTISQEELYPQADESTRQELDDAHRLDLDVDDESPFLRGQ
Ga0184619_1006695333300018061Groundwater SedimentMARKNGPTISQEELYPQSDEPTRQDLDDARLLDLDAEQESPFLRGQK
Ga0066669_1000814513300018482Grasslands SoilMARKFDPTISQEELYPPAEESRREEVHDARLLDLDV
Ga0210403_1127661223300020580SoilMARKSGSTIAQEELYPPPHEPVRPASEDALDDARLLDLDV
Ga0210401_1026940123300020583SoilMARKSGSTISQEELYPPSHEPARPVPDDALDDARMLDLDVEQESPFLRGQKR
Ga0210405_1019305113300021171SoilMARKSSPTILQEELYPPPGEPERELDNARLVDLDVEEES
Ga0210396_1100950023300021180SoilMARKSSPTISQEELYPLTDDAVREDLDDARLLDLDVEQESPFLRAQKRVS
Ga0210389_1117807623300021404SoilMARKGSSTISQEELYPAVHEPARPATDDTLDDARMLDLDVEQES
Ga0210389_1140815513300021404SoilMARKGGSTISQEELYPPAHEPARPAPDGALDDARMLDLDVEQESPFL
Ga0210384_1099188123300021432SoilMARKSPTISQDELYSQPEESVREEVDDPRALDLDVEQESPFLRGQKR
Ga0210398_1062472323300021477SoilMARKVSSTISQEELYPQADEPARQELDDAHRLDLD
Ga0210398_1111019013300021477SoilMARKGSSTISQEELYPAVHEPARPATDDTLDDARMLDLDVEQESP
Ga0212123_1068533423300022557Iron-Sulfur Acid SpringMARKGSSTISQEELYPAVHEPARPAPDDTLDDARMLDLDVEQES
Ga0242654_1008324513300022726SoilMARKSGSTISQEELYPPAHEPARPVPDDALDDARMLDLDAAQESPFLRGQK
Ga0208219_112568113300025625Arctic Peat SoilMARKSGSTISQEELYPQPDEPVREEVDDPRLLDLD
Ga0207646_1101925623300025922Corn, Switchgrass And Miscanthus RhizosphereMARKSPTITQDELYPPDEEFARQDIDDARLLDLDLE
Ga0207664_1063999023300025929Agricultural SoilMARKSSPTILQEELYPPPGEPERELDNARLVDLDVEEESPFLRG
Ga0209236_123896723300026298Grasslands SoilMARKTGPTISQEECYPLADEPVREELDDARLLDLDVEQESPFLR
Ga0209468_110695413300026306SoilMARKTPTISQEELYLQPDEPVREELDDARLLDLDAEE
Ga0209686_100633163300026315SoilMARKTPTISQEESYLQPDEPVREELDDARLLDLDAEEESPFLRGQKRVSVRR
Ga0209472_110003933300026323SoilMARKTPTISQEESYLQPDEPVREELDDARLLDLDAEE
Ga0209470_115746433300026324SoilMARKSSPTISQDELYPPSEEFAREEIEDARLLDLDVEQESP
Ga0209158_130001623300026333SoilMARKSPTITQDELYPPDEEFARQDIDDARLLDLDVEQES
Ga0209377_123242323300026334SoilMARKSPTITQDELYPPDEEFARQDIDDARLLDLDVEQESPFLRAQKRV
Ga0209059_114496513300026527SoilMARKSPTITQDELYPPDEEFARQDIDDARLLDLDVEQESPFLRAQKRVSV
Ga0208827_104099633300027641Peatlands SoilMARKSGSTISQEELYPPAHEPARPAPDDALDHARMLDLEVEQESP
Ga0209465_1016132113300027874Tropical Forest SoilMARKSSPTIVQEELYPPPGEPEREVLDDARLLDLDVEEESPFLR
Ga0209006_1110203523300027908Forest SoilMARKSGSTISQEELYPQADEPSRQELDDAHRLDLDVDEQSPFL
Ga0308309_1020863213300028906SoilMARKSGPTILQEELYPSSAEAAREEMDDARLLDLDVDEESPFLRGQKRVS
Ga0316363_1032121223300030659Peatlands SoilMARKSGSTILQEESYPPAHEPSRPVPDDGLDDACLLDLDVEQESPFLRGQKRVS
Ga0307469_1127748013300031720Hardwood Forest SoilMARKSGPTIEQEELYPPPDESGRGELDDARVLDLEVEQES
Ga0307468_10005075233300031740Hardwood Forest SoilMARKSAPTISQEELYPESDEPTRQDLDDARLLDLDAEQESPFLR
Ga0307468_10240935313300031740Hardwood Forest SoilMARKSGPTISQEELYPLADEPRREEVHDARLLELDVEQEPPFLRVQ
Ga0307473_1109265923300031820Hardwood Forest SoilMARKGSSTISQEELYPTSHEPVREELDDARTLDLDVDQESPFLRGQKRFS
Ga0307478_1005001913300031823Hardwood Forest SoilMARKSGSTISQEELYPPSEVRDEPLREEFDGARMIDLDAEQESP
Ga0306926_1269987613300031954SoilMARKSSPTILQEELYLAPEVSERESPDDARRFDLDVEEES
Ga0307471_10070340313300032180Hardwood Forest SoilMARKTGPPISQEELYPVSDELPREDLDDARLLDLDVEQESPFLRAQ
Ga0307472_10078943313300032205Hardwood Forest SoilMARKNGPTISQEELYPLADEPGREEGARLLDLDAEQE
Ga0335079_1178629813300032783SoilMARKASSTISQEELYPQADEPVREALDDARLLDLDVEEES
Ga0335078_1058577533300032805SoilMARKSGSTIVQEELYPQSDEPVGTPELDDARLVDLDVEQESPFLRGQ
Ga0335078_1125921023300032805SoilMARKASSTISQEELYPQMDEPAPEPLDDARLLDLDVEEES
Ga0335080_1059755633300032828SoilMARKASSTISQEELYPQADEAVRPEVDDARLLDLDV
Ga0335071_1161486323300032897SoilMARKSPTISQDELYSQPDEPVREERDDPRALDLDVEQESPFL
Ga0335077_1063937723300033158SoilMARKASSTISQEELYPRSDDDVRADLDDARPIDLDVEEESPFLRA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.