NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101561

Metagenome / Metatranscriptome Family F101561

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101561
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 50 residues
Representative Sequence DRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKSLQKSR
Number of Associated Samples 99
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 1.96 %
% of genes near scaffold ends (potentially truncated) 97.06 %
% of genes from short scaffolds (< 2000 bps) 88.24 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (51.961 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(25.490 % of family members)
Environment Ontology (ENVO) Unclassified
(28.431 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(35.294 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 2.17%    β-sheet: 21.74%    Coil/Unstructured: 76.09%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF01926MMR_HSR1 78.43
PF14714KH_dom-like 12.75
PF00202Aminotran_3 5.88
PF04149DUF397 0.98
PF13649Methyltransf_25 0.98



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A51.96 %
All OrganismsrootAll Organisms48.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573001|GZR05M101A3OH6Not Available514Open in IMG/M
2189573004|GZGWRS401AJKFUAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales532Open in IMG/M
2199352024|deeps__Contig_182618Not Available776Open in IMG/M
3300004114|Ga0062593_102751248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia561Open in IMG/M
3300005174|Ga0066680_10432538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia833Open in IMG/M
3300005176|Ga0066679_10702231All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300005332|Ga0066388_108758517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia502Open in IMG/M
3300005338|Ga0068868_101688726All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300005339|Ga0070660_101278650All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300005459|Ga0068867_100110164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2114Open in IMG/M
3300005468|Ga0070707_100180904All Organisms → cellular organisms → Bacteria2055Open in IMG/M
3300005471|Ga0070698_100033036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales5360Open in IMG/M
3300005518|Ga0070699_101538563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia610Open in IMG/M
3300005535|Ga0070684_100247090All Organisms → cellular organisms → Bacteria1630Open in IMG/M
3300005543|Ga0070672_100107311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2272Open in IMG/M
3300005545|Ga0070695_101190098All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300005553|Ga0066695_10319608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia977Open in IMG/M
3300005564|Ga0070664_100212651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1728Open in IMG/M
3300005568|Ga0066703_10740351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia564Open in IMG/M
3300005575|Ga0066702_10499429All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300005843|Ga0068860_100457527All Organisms → cellular organisms → Bacteria1269Open in IMG/M
3300006032|Ga0066696_10313050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1021Open in IMG/M
3300006176|Ga0070765_100785710All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300006800|Ga0066660_10752365All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300007788|Ga0099795_10009732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2801Open in IMG/M
3300009545|Ga0105237_11797570Not Available620Open in IMG/M
3300010048|Ga0126373_10830524Not Available987Open in IMG/M
3300010303|Ga0134082_10285180Not Available689Open in IMG/M
3300010325|Ga0134064_10119445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia885Open in IMG/M
3300010375|Ga0105239_12264723Not Available632Open in IMG/M
3300010865|Ga0126346_1270995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2469Open in IMG/M
3300012201|Ga0137365_10191989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium kansasii1528Open in IMG/M
3300012201|Ga0137365_11299003Not Available516Open in IMG/M
3300012207|Ga0137381_11551602Not Available553Open in IMG/M
3300012351|Ga0137386_11003431Not Available594Open in IMG/M
3300012351|Ga0137386_11251890Not Available517Open in IMG/M
3300012353|Ga0137367_10755799Not Available676Open in IMG/M
3300012387|Ga0134030_1300425Not Available771Open in IMG/M
3300012476|Ga0157344_1017533Not Available589Open in IMG/M
3300012482|Ga0157318_1013209Not Available648Open in IMG/M
3300012490|Ga0157322_1015573Not Available678Open in IMG/M
3300012513|Ga0157326_1078015Not Available537Open in IMG/M
3300012960|Ga0164301_11588550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia542Open in IMG/M
3300012975|Ga0134110_10380181Not Available623Open in IMG/M
3300017933|Ga0187801_10280632Not Available674Open in IMG/M
3300017936|Ga0187821_10190644Not Available785Open in IMG/M
3300017942|Ga0187808_10154167Not Available1013Open in IMG/M
3300018089|Ga0187774_10903272Not Available607Open in IMG/M
3300018482|Ga0066669_10628854Not Available943Open in IMG/M
3300019361|Ga0173482_10375383Not Available653Open in IMG/M
3300020012|Ga0193732_1040969Not Available797Open in IMG/M
3300021178|Ga0210408_10117098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2099Open in IMG/M
3300021406|Ga0210386_11003343Not Available712Open in IMG/M
3300021432|Ga0210384_11434742Not Available595Open in IMG/M
3300021857|Ga0213849_1267346Not Available637Open in IMG/M
3300024178|Ga0247694_1025657Not Available661Open in IMG/M
3300024279|Ga0247692_1064473Not Available572Open in IMG/M
3300025900|Ga0207710_10063630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1679Open in IMG/M
3300025904|Ga0207647_10256863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1001Open in IMG/M
3300025916|Ga0207663_10921418Not Available699Open in IMG/M
3300025931|Ga0207644_10139467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1865Open in IMG/M
3300025932|Ga0207690_11742842Not Available520Open in IMG/M
3300026023|Ga0207677_10777881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia855Open in IMG/M
3300026041|Ga0207639_11441750Not Available646Open in IMG/M
3300026304|Ga0209240_1190999Not Available619Open in IMG/M
3300026310|Ga0209239_1206818Not Available700Open in IMG/M
3300026343|Ga0209159_1232962Not Available564Open in IMG/M
3300026490|Ga0257153_1094678Not Available594Open in IMG/M
3300026557|Ga0179587_10845962Not Available603Open in IMG/M
3300027512|Ga0209179_1078760All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300027725|Ga0209178_1317114Not Available577Open in IMG/M
3300027824|Ga0209040_10041743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2823Open in IMG/M
3300028714|Ga0307309_10165331Not Available567Open in IMG/M
3300030510|Ga0268243_1105002Not Available659Open in IMG/M
3300031546|Ga0318538_10380760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria763Open in IMG/M
3300031549|Ga0318571_10241289Not Available661Open in IMG/M
3300031564|Ga0318573_10179531Not Available1118Open in IMG/M
3300031680|Ga0318574_10386690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia817Open in IMG/M
3300031681|Ga0318572_10024363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3082Open in IMG/M
3300031682|Ga0318560_10190894Not Available1093Open in IMG/M
3300031770|Ga0318521_11032631Not Available504Open in IMG/M
3300031798|Ga0318523_10152187Not Available1150Open in IMG/M
3300031805|Ga0318497_10035552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2508Open in IMG/M
3300031819|Ga0318568_10024380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3316Open in IMG/M
3300031846|Ga0318512_10054284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium kansasii1795Open in IMG/M
3300031860|Ga0318495_10310920Not Available700Open in IMG/M
3300031894|Ga0318522_10130866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia941Open in IMG/M
3300031897|Ga0318520_10121236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium kansasii1489Open in IMG/M
3300031947|Ga0310909_10868787Not Available742Open in IMG/M
3300032001|Ga0306922_10377148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium kansasii1520Open in IMG/M
3300032041|Ga0318549_10194450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia910Open in IMG/M
3300032054|Ga0318570_10264876Not Available780Open in IMG/M
3300032064|Ga0318510_10407304Not Available580Open in IMG/M
3300032066|Ga0318514_10640849Not Available565Open in IMG/M
3300032770|Ga0335085_12251247Not Available546Open in IMG/M
3300032897|Ga0335071_10033905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5069Open in IMG/M
3300032954|Ga0335083_10704613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia819Open in IMG/M
3300032954|Ga0335083_11320946Not Available554Open in IMG/M
3300033004|Ga0335084_10981354Not Available852Open in IMG/M
3300033158|Ga0335077_10513271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1265Open in IMG/M
3300033289|Ga0310914_10289387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium kansasii1476Open in IMG/M
3300033412|Ga0310810_11334988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia559Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.49%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.84%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere3.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.96%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil1.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.96%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.98%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.98%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010865Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012387Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012476Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610Host-AssociatedOpen in IMG/M
3300012482Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510Host-AssociatedOpen in IMG/M
3300012490Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610Host-AssociatedOpen in IMG/M
3300012513Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510Host-AssociatedOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020012Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1EnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021857Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - WE:C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024178Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35EnvironmentalOpen in IMG/M
3300024279Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027512Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300030510Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2)EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD2_042973202189573001Grass SoilRAGRRAAEAGWSTQAEVDRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLALQKSR
FG2_101286502189573004Grass SoilMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLALQKSR
deeps_034263502199352024SoilGPGRRRAAEASWSTQAEVDRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKPLQKSR
Ga0062593_10275124813300004114SoilADGAARASRRAAEASWSTRADQDRRDQMDAAQSGKAADAVDVDTTGLDLDGVVGVIVGLVLQKSR*
Ga0066680_1043253813300005174SoilRRDRMDAAQSGKAADAVEVDSTGLDLDQVVGVIVGLALQKSR*
Ga0066679_1070223123300005176SoilRDRMDAAQSGKAADAVEVDSTGLDLNEVVGVIVGLVPKYLQKSR*
Ga0066388_10875851713300005332Tropical Forest SoilWSTRAEVDRRDRMDEAQSGKAADAVEIDSTGLGLDQVVGIIVGLALQKSR*
Ga0068868_10168872623300005338Miscanthus RhizosphereRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKPLQKSR*
Ga0070660_10127865013300005339Corn RhizosphereDRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKPLQKSR*
Ga0068867_10011016413300005459Miscanthus RhizosphereAEASWSTRADQDRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKSLQKSR*
Ga0070707_10018090433300005468Corn, Switchgrass And Miscanthus RhizosphereDRRDRMDAAQSGKAGDAVEVDSTELDLDGVVGVIVGLVPKPLQKSR*
Ga0070698_10003303613300005471Corn, Switchgrass And Miscanthus RhizosphereDRLDAAQSGKAADAVEIDSTGLGLDEVVGIIVGLVPQKSR*
Ga0070699_10153856323300005518Corn, Switchgrass And Miscanthus RhizosphereDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKPLQKSR*
Ga0070684_10024709023300005535Corn RhizosphereRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKSLQKSR*
Ga0070672_10010731133300005543Miscanthus RhizosphereADQDRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKSLQKSR*
Ga0070695_10119009823300005545Corn, Switchgrass And Miscanthus RhizosphereQERRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKSLQKSR*
Ga0066695_1031960813300005553SoilRAAEANWSTQAEVDRRDRMDAAQSGKAADAVEVDSTGLDLDEVVGVIVGLALQKSR*
Ga0070664_10021265113300005564Corn RhizosphereDQDRRDRMDAAQSGKAADAIEVDSTGLDLDGVVGVIVGLVPKSLQKSR*
Ga0066703_1074035123300005568SoilSWSTRADQDRRDRMDAAQSGKAADAVEVDSTGLDLDAVVGVIVGLALQKSR*
Ga0066702_1049942923300005575SoilDRRDRMDAAQSGKAADAVEVDSTGLDLDAVVGVIVGLALQKSR*
Ga0068860_10045752723300005843Switchgrass RhizosphereAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKSLQKSR*
Ga0066696_1031305023300006032SoilASRRAAEASWSTRAEVDRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLALQKSR*
Ga0070765_10078571023300006176SoilSGKAADAVEVDSTGLDLDEVVGVIVGLVPKYLQKSR*
Ga0066660_1075236513300006800SoilQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKSLQKSR*
Ga0099795_1000973233300007788Vadose Zone SoilSRASRRAAEASWTTQAEVDRRDRMDAPQSGKAADAVEVDSTGLGLDEVVGVIVGLALQKSR*
Ga0105237_1179757023300009545Corn RhizosphereDGASRASRRAAEASWTTQAEVDRRDRMDAPQSGKAADAVEVDSTGLDLAEVVGVIVGLALQKSR*
Ga0126373_1083052423300010048Tropical Forest SoilAAEASWSTQAEVDRRDRMDAAQSGKAADAVEVDSTGLDLDEVVGVIVGLALQKSR*
Ga0134082_1028518023300010303Grasslands SoilASRRAAEASSSTRAEVDRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKPLHKSR*
Ga0134064_1011944513300010325Grasslands SoilTRAEVDRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGFALQKSR*
Ga0105239_1226472323300010375Corn RhizosphereRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKSLQKSR*
Ga0126346_127099513300010865Boreal Forest SoilQSGKAADAVVVDSTGLSLDEVVGIIVGLALQKSR*
Ga0137365_1019198913300012201Vadose Zone SoilKAADAVEVDSTGLDLDGVVGVIVGLVPKPLQKSR*
Ga0137365_1129900313300012201Vadose Zone SoilRRDRMDAAQSEKAADAVEVDSTGLDLDEVVGVIVGLAMQKSR*
Ga0137381_1155160213300012207Vadose Zone SoilMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKPLQKSR*
Ga0137386_1100343113300012351Vadose Zone SoilAEASWSTQAEVDRRDRMDAAQIGKAGDAVEVDSTELDLDGVVGVIVGLALQKSR*
Ga0137386_1125189023300012351Vadose Zone SoilAQSGKAADAVQIDSTGLGLDEVVGIIVGLVPQKSR*
Ga0137367_1075579913300012353Vadose Zone SoilGRRAAEASWSTQAEVDRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKPLQKSR*
Ga0134030_130042513300012387Grasslands SoilRRDRMDAAQSGKAADAVEVDSTGLDLNEVVGVIVGLVPKYLQKSR*
Ga0157344_101753313300012476Arabidopsis RhizosphereQSGKAADAVEVDSTGLDLDEVVGVIVGLVPKYLQKSR*
Ga0157318_101320923300012482Arabidopsis RhizosphereDRMDAAQSGKAADAVEIDSTGLGLDQVVGIIVGLVPKPLQKSR*
Ga0157322_101557313300012490Arabidopsis RhizosphereKAADAVEVDSTGLDLDGVVGVIVGLVPKSLQKSR*
Ga0157326_107801513300012513Arabidopsis RhizosphereRMDAAQSEKAADAVEVDSTGLDLDGVVGVIVGLVPKPLQKSR*
Ga0164301_1158855023300012960SoilRAVEASGSTQADQHPRDRMDAAQSGKAADAVEVDSTGLDLAEVVGIIVGLALQTSR*
Ga0134110_1038018123300012975Grasslands SoilMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLALQKSR*
Ga0187801_1028063223300017933Freshwater SedimentDAAQSGKAADAVEIDSTGLGLDEVVGIIVGLVPQSLQKSR
Ga0187821_1019064413300017936Freshwater SedimentSRRAAEASWTTRAEVDRRDRMDAAQSGKAADAVEVDSTGLDLDEVVGVIVGLVPKYLQQS
Ga0187808_1015416723300017942Freshwater SedimentLDAAQSGKADAVEIDSTGLGLDEVVGLIVGLVPQALQKSR
Ga0187774_1090327223300018089Tropical PeatlandDQDRRDRLDAAQSGKAADAVEIDSTGLGLDEVIGLIVGLVPQSLQKSR
Ga0066669_1062885423300018482Grasslands SoilAEVDRGDRMDAAQSGKAADAVEVDSTGLDLDEVVGVIVGLVPKYLQKSR
Ga0173482_1037538313300019361SoilAARASRRAAEASWSTRADQDRRDRMDAAQSGKAADAIEVDSTGLDLDGVVGVIVGLVPKSLQKSR
Ga0193732_104096923300020012SoilEVDRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKPLQKSR
Ga0210408_1011709833300021178SoilRADRRAAEASWSTRADQDRRDRMDAAQSGKAADAVEVDSTGLDLDAVVGVIVGLALQKSR
Ga0210386_1100334313300021406SoilAQSGKAADAVEIDSTGLGLDEVVGIIVGLSLQKSR
Ga0210384_1143474213300021432SoilQSGKAADAVEVDSTGLDLNEVVGVIVGLVPKYLQKSR
Ga0213849_126734613300021857WatershedsRRDRMDAAQSGKAADAVEVDSTGLDLAEVVGVIVGLVPKYLQKSR
Ga0247694_102565723300024178SoilSRRAAEASWSTRADQDRRDRMDAAQSGKAADAIEVDSTGLDLDGVVGVIVGLVPKSLQKS
Ga0247692_106447323300024279SoilDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKSLQKSR
Ga0207710_1006363013300025900Switchgrass RhizosphereAAEASWSTRADQDRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKSLQKSR
Ga0207647_1025686313300025904Corn RhizosphereDRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKSLQKSR
Ga0207663_1092141813300025916Corn, Switchgrass And Miscanthus RhizosphereEVDRRDQMDAPQSGKAADAVEVDSTGLGLDEVVGVIVGLALQKSR
Ga0207644_1013946713300025931Switchgrass RhizosphereGKAADAVEVDSTGLDLDGVVGVIVGLVPKSLQKSR
Ga0207690_1174284223300025932Corn RhizosphereAAEASWSTQADQDRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKSLQKSR
Ga0207677_1077788113300026023Miscanthus RhizosphereDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKSLQKSR
Ga0207639_1144175013300026041Corn RhizosphereQDRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKSLQKSR
Ga0209240_119099923300026304Grasslands SoilAAEASWSTQADQDRRDRMDAAQSGKAADAVEVDSTGLGLDEVVGVIVGLALQKSR
Ga0209239_120681823300026310Grasslands SoilGVDRRDRMDAAQSGKAGDAVEVDSTELDLDGVVGVIVGLVPKPLQKSR
Ga0209159_123296223300026343SoilRAAEANWSTQAEVDRRDRMDAAQSGKAADAVEVDSTGLDLDEVVGVIVGLALQKSR
Ga0257153_109467813300026490SoilRAAEASWSTQADQDRRDRMDAAQSGKAADAVEVDSTGLGLDEVVGVIVGLALQKSR
Ga0179587_1084596223300026557Vadose Zone SoilRRAAEASWSTQADQDRRDRMDAAQSGKAADAVEVDSTGLGLDEVVGVIVGLALQKSR
Ga0209179_107876023300027512Vadose Zone SoilMAADQDRRDRMDAAQSGKAADAVEVDSTGLGLDEVVGVIVGLALQKSR
Ga0209178_131711413300027725Agricultural SoilRDRMDAAQSGKAADAVEVDSTGLDLDGVVGIIVGLVPKSLQKSR
Ga0209040_1004174343300027824Bog Forest SoilRDRLDAAQSGKAADAVEIDSTGLGLDEVVGIIVGLVPQALQKSR
Ga0307309_1016533113300028714SoilTQAEVDRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKSLQKSR
Ga0268243_110500223300030510SoilAEANWSTRAEVDRRDQMDAAQSGKAADAVEVDSTGLDLDEVVSVIVGLALQKSR
Ga0318538_1038076013300031546SoilARASRRAGEATWSTQAEVDRRDRMDAAQSGKAADAVEVDSTGLSLDQVIGIIVGLALQKRQKSR
Ga0318571_1024128923300031549SoilRASRRAGEASWSTRAEVDRRDRMDAAQSGKAADAVEVDSTGLDLDEVTGIIVGLALQKSK
Ga0318573_1017953123300031564SoilARASRRAAEASWSTRAEVDRRDRMDAAQSGKAADAVQIDSTGLGLDQVVGIIVGLALQKS
Ga0318574_1038669023300031680SoilDGSARASRRAAEASWSTRAEVDRRDRMDAAQSGKAADAVQIDSTGLGLDQVVGIIVGLALQKSR
Ga0318572_1002436313300031681SoilAGASRRAAAASWPTRAVVDRRDRMDAAQSGKAADAVQIDSTGLGLDQVVGIIVGLALQKS
Ga0318560_1019089413300031682SoilASRRAGEASWSTRAEVDRRDRMDAAQSGKAADAVEVDSTGLGLDEVVGIIVGLVLQKSK
Ga0318521_1103263123300031770SoilASRRAGEASWSTRAEVDRRDRMDAAQSGKAADAVEVDSTGLDLDEVTGIIVGLALQKSK
Ga0318523_1015218713300031798SoilAASWSTRAEVDRRDRMDAAQSGKAADAVQIDSTGLGLDQVVGIIVGLALQKSR
Ga0318497_1003555233300031805SoilRAVVDRRDRMDAAQSGKAADAVQIDSTGLGLDQVVGIIVGLALQKSR
Ga0318568_1002438043300031819SoilAAEASWSTRAEVDRRDRMDAAQSGKAADAVQIDSTGLGLDQVVGIIVGLALQKSR
Ga0318512_1005428413300031846SoilAGEATWSTQAEVDRRDRMDAAQSGKAADAVEVDSTGLSLDQVIGIIVGLALQKRQKSR
Ga0318495_1031092013300031860SoilTRAEVDRRDRMDAAQSGKAADAVQIDSTGLGLDQVVGIIVGLALQKSR
Ga0318522_1013086623300031894SoilDRRDRMDAAQSGKAADAVEVDSTGLSLDQVIGIIVGLALQKRQKSR
Ga0318520_1012123623300031897SoilVDRRDRMDAAQSGKAADAVQIDSTGLGLDQVVGIIVGLALQKSR
Ga0310909_1086878723300031947SoilTADGAARAGRRAAEASWSTRAEVDRRDRMDAAQSGKAADAVEVDSTGLGLAEVVGIIVGLVPKSLKKSR
Ga0306922_1037714823300032001SoilASWSTRAEVDRRDRMDAAQSGKAADAVQIDSTGLGLDQVVGIIVGLALQKSR
Ga0318549_1019445023300032041SoilTSARVDRRDRMDAAQSGKAADAVEVDSTGLDLDEVTGIIVGLALQKSK
Ga0318570_1026487613300032054SoilLTADGAARASRRAGEATWSTQAEVDRRDRMDAAQSGKAADAVQIDSTGLGLDQVVGIIVGLALQKSR
Ga0318510_1040730413300032064SoilASRRAAEASWSTQAEVDRRDRMDAAQSGKAADAVEIDSTGLGLDQVVGVIVGLALQKSR
Ga0318514_1064084913300032066SoilAAQSGKAADAVQIDSTGLGLDQVVGIIVGLALQKSR
Ga0335085_1225124723300032770SoilSTQAVVDRRDRMDAAQSGKAADAVEIDSTGLGLDQVVGIIVGLALQKSR
Ga0335071_1003390563300032897SoilMDAAQSSQAADAVEVDSTGLDLDEVVAIIVGLVPKSARKST
Ga0335083_1070461323300032954SoilEAGWSTRAEVDRRDRMDAAQSGKAADAVEVDSTGLDLNGVVGVIVGLVPKPLQKSR
Ga0335083_1132094623300032954SoilEVDRRDRMDAAQSGKAADAVEVDSTGLGLDEVVGIIVGLALQKSR
Ga0335084_1098135413300033004SoilAARAGRRAAVASWSTLAAVDRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKPLQKSR
Ga0335077_1051327123300033158SoilADGAARAGRRAAEASWSTQAEVDRRDRMDAAQSGKAADAVEVDSTGLDLNGVVGVIVGLVPKPLQKSR
Ga0310914_1028938723300033289SoilSTRAEVDRRDRMDAAQSGKAADAVQIDSTGLGLDQVVGIIVGLALQKSR
Ga0310810_1133498823300033412SoilRRAAEASWSTRADQDRRDRMDAAQSGKAADAVEVDSTGLDLDGVVGVIVGLVPKSLQKSR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.