NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F101533

Metagenome Family F101533

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101533
Family Type Metagenome
Number of Sequences 102
Average Sequence Length 45 residues
Representative Sequence MKVRGTTAGTPFGAKLTALCWGALTLLAPVAVSACTSSSST
Number of Associated Samples 98
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 91.18 %
% of genes from short scaffolds (< 2000 bps) 88.24 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (51.961 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(32.353 % of family members)
Environment Ontology (ENVO) Unclassified
(26.471 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.176 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 40.58%    β-sheet: 0.00%    Coil/Unstructured: 59.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF04203Sortase 33.33
PF03551PadR 2.94
PF01351RNase_HII 2.94
PF03450CO_deh_flav_C 1.96
PF01326PPDK_N 0.98
PF01678DAP_epimerase 0.98
PF14236DUF4338 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG3764Sortase (surface protein transpeptidase)Cell wall/membrane/envelope biogenesis [M] 33.33
COG0164Ribonuclease HIIReplication, recombination and repair [L] 2.94
COG1039Ribonuclease HIIIReplication, recombination and repair [L] 2.94
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 2.94
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 2.94
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 2.94
COG0253Diaminopimelate epimeraseAmino acid transport and metabolism [E] 0.98
COG0574Phosphoenolpyruvate synthase/pyruvate phosphate dikinaseCarbohydrate transport and metabolism [G] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A51.96 %
All OrganismsrootAll Organisms48.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005164|Ga0066815_10019990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia927Open in IMG/M
3300005175|Ga0066673_10525976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia695Open in IMG/M
3300005181|Ga0066678_10651839Not Available701Open in IMG/M
3300005435|Ga0070714_101535299Not Available650Open in IMG/M
3300005435|Ga0070714_102052305Not Available557Open in IMG/M
3300005437|Ga0070710_10939426Not Available626Open in IMG/M
3300005439|Ga0070711_100465564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1037Open in IMG/M
3300005467|Ga0070706_101409475Not Available638Open in IMG/M
3300005557|Ga0066704_10906819Not Available545Open in IMG/M
3300005564|Ga0070664_101729937Not Available593Open in IMG/M
3300006050|Ga0075028_100737588Not Available596Open in IMG/M
3300006059|Ga0075017_100563469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia868Open in IMG/M
3300006176|Ga0070765_101683934Not Available596Open in IMG/M
3300006854|Ga0075425_100381026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1624Open in IMG/M
3300006854|Ga0075425_101692047Not Available712Open in IMG/M
3300007076|Ga0075435_101357542Not Available623Open in IMG/M
3300007788|Ga0099795_10064699All Organisms → cellular organisms → Bacteria1366Open in IMG/M
3300009093|Ga0105240_11020691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia884Open in IMG/M
3300009522|Ga0116218_1157822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1029Open in IMG/M
3300009672|Ga0116215_1495519Not Available528Open in IMG/M
3300009698|Ga0116216_10906261Not Available527Open in IMG/M
3300010048|Ga0126373_12439444Not Available582Open in IMG/M
3300012189|Ga0137388_10173595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1927Open in IMG/M
3300012207|Ga0137381_10290499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1423Open in IMG/M
3300012209|Ga0137379_10208172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1870Open in IMG/M
3300012211|Ga0137377_10532770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1112Open in IMG/M
3300012350|Ga0137372_10306466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1229Open in IMG/M
3300012478|Ga0157328_1002669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia877Open in IMG/M
3300012497|Ga0157319_1006437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia843Open in IMG/M
3300012929|Ga0137404_10356608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1281Open in IMG/M
3300012960|Ga0164301_10527957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia857Open in IMG/M
3300012960|Ga0164301_10817758Not Available714Open in IMG/M
3300014969|Ga0157376_11733070Not Available660Open in IMG/M
3300015372|Ga0132256_103185461Not Available552Open in IMG/M
3300016319|Ga0182033_11064271Not Available721Open in IMG/M
3300016404|Ga0182037_11130444Not Available686Open in IMG/M
3300017959|Ga0187779_10041126Not Available2681Open in IMG/M
3300018058|Ga0187766_10139707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1497Open in IMG/M
3300018086|Ga0187769_11187534Not Available577Open in IMG/M
3300019890|Ga0193728_1138007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1086Open in IMG/M
3300020582|Ga0210395_10796843Not Available704Open in IMG/M
3300020583|Ga0210401_10270282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1560Open in IMG/M
3300021171|Ga0210405_10251644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1398Open in IMG/M
3300021181|Ga0210388_10243811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1577Open in IMG/M
3300021407|Ga0210383_11672804Not Available522Open in IMG/M
3300021432|Ga0210384_11403179Not Available604Open in IMG/M
3300021474|Ga0210390_11156543Not Available626Open in IMG/M
3300021478|Ga0210402_10934892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia794Open in IMG/M
3300024222|Ga0247691_1025293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia920Open in IMG/M
3300024225|Ga0224572_1014777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1492Open in IMG/M
3300024245|Ga0247677_1003021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2141Open in IMG/M
3300025921|Ga0207652_11730093Not Available530Open in IMG/M
3300025928|Ga0207700_10133741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2028Open in IMG/M
3300025929|Ga0207664_11201912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia676Open in IMG/M
3300025934|Ga0207686_10052749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2539Open in IMG/M
3300025972|Ga0207668_11074416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia721Open in IMG/M
3300026557|Ga0179587_10211674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1231Open in IMG/M
3300027662|Ga0208565_1174503Not Available619Open in IMG/M
3300027662|Ga0208565_1186751Not Available594Open in IMG/M
3300027725|Ga0209178_1147030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia812Open in IMG/M
3300027812|Ga0209656_10145769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1192Open in IMG/M
3300027898|Ga0209067_10405070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia764Open in IMG/M
3300028072|Ga0247675_1002028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2594Open in IMG/M
3300028720|Ga0307317_10052598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1307Open in IMG/M
3300028906|Ga0308309_11025763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia714Open in IMG/M
3300030494|Ga0310037_10105179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1306Open in IMG/M
3300031545|Ga0318541_10770589Not Available537Open in IMG/M
3300031572|Ga0318515_10098218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1533Open in IMG/M
3300031668|Ga0318542_10169655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1091Open in IMG/M
3300031680|Ga0318574_10732810Not Available579Open in IMG/M
3300031681|Ga0318572_10813854Not Available555Open in IMG/M
3300031718|Ga0307474_11216100Not Available596Open in IMG/M
3300031719|Ga0306917_11213535Not Available585Open in IMG/M
3300031720|Ga0307469_12123181Not Available546Open in IMG/M
3300031751|Ga0318494_10811691Not Available548Open in IMG/M
3300031765|Ga0318554_10704877Not Available566Open in IMG/M
3300031770|Ga0318521_10160195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1282Open in IMG/M
3300031777|Ga0318543_10488488Not Available552Open in IMG/M
3300031780|Ga0318508_1182845Not Available599Open in IMG/M
3300031819|Ga0318568_10186415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1277Open in IMG/M
3300031835|Ga0318517_10187928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia929Open in IMG/M
3300031845|Ga0318511_10454083Not Available590Open in IMG/M
3300031897|Ga0318520_10675984Not Available644Open in IMG/M
3300031912|Ga0306921_10381856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1646Open in IMG/M
3300032008|Ga0318562_10464525Not Available734Open in IMG/M
3300032009|Ga0318563_10466909Not Available682Open in IMG/M
3300032063|Ga0318504_10425613Not Available634Open in IMG/M
3300032064|Ga0318510_10417200Not Available573Open in IMG/M
3300032065|Ga0318513_10474300Not Available612Open in IMG/M
3300032094|Ga0318540_10204879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia951Open in IMG/M
3300032205|Ga0307472_100953008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia799Open in IMG/M
3300032770|Ga0335085_10639487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1191Open in IMG/M
3300032782|Ga0335082_10447297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1155Open in IMG/M
3300032898|Ga0335072_11712324Not Available524Open in IMG/M
3300032955|Ga0335076_10854723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia791Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil32.35%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.84%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil7.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.94%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.94%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.94%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012478Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610Host-AssociatedOpen in IMG/M
3300012497Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510Host-AssociatedOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300024222Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32EnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028072Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI26341J46601_1009463113300003219Bog Forest SoilMKVRTTTAGAARRARLTALSWGALTLLAPVAVSACSGSASTPNVPTFTPSVSISGTVTAPGS
Ga0066815_1001999013300005164SoilMKVRGATAGTPFGARLTALCWGALTLLAPVAVSACTSSTSTTTPTVIS
Ga0066673_1052597613300005175SoilMKVRGATTGTPFGARLTALCWGALTLLVPVAVSACTSSSST
Ga0066678_1065183923300005181SoilMKVRTTIAGTALSARLTAVCWGALTLLAPAAVSACTSSSSS
Ga0070714_10153529913300005435Agricultural SoilMKVRGTTAGTPFGAKLAALCWGALTLLAPVAVSACTSSSSTSPT
Ga0070714_10205230523300005435Agricultural SoilMKVRGTTAGTPFGAKLTALCWGALTLLAPVAVSACTSSSSTSPTI
Ga0070710_1093942623300005437Corn, Switchgrass And Miscanthus RhizosphereMKVRGTTAGAPLGAKLTALCWGALTLLAPVAVSACTSGSSSSPTIISPT
Ga0070711_10046556413300005439Corn, Switchgrass And Miscanthus RhizosphereMKVRGAIAGRPLGARLTALCWGALILLAPVAVSACTSGSSTSTPTVPT
Ga0070706_10140947523300005467Corn, Switchgrass And Miscanthus RhizosphereMKVRGTTASTPFGAKLTAVCWGALTLLVPVAVSACTSGSSSSPTIIAPTV
Ga0066704_1090681923300005557SoilMKVRGMTAGTTFGAKLTVLGWGALTLLAPVAISACTSSSSSST
Ga0070664_10172993733300005564Corn RhizosphereMKVRGTTLGVKLTALCWGALALLAPVALAACSSSSP
Ga0075028_10073758813300006050WatershedsMKVQTTVAGTALRARLSALCWGALIILAPVAVSACSGSSSTP
Ga0075017_10056346923300006059WatershedsMKVRTTIAGTAFRARLTAVCWGALTLLAPVAVSACSGSTSTP
Ga0070765_10168393433300006176SoilMKVRTTRAGTALGARLTAICWGALVLLALATVSAC
Ga0075425_10038102633300006854Populus RhizosphereMKVRGTTAGAPFGAKLTALCWGALTLLAPVTVSACTSGSSSSPTIIAP
Ga0075425_10169204713300006854Populus RhizosphereMKVRGTIAGTPLGATLTALCWGALALLAPVALSACTSSTSTTPPTVFS
Ga0075435_10135754223300007076Populus RhizosphereMKVRGTTVGTPFGAKLTALCWGALTLLAPVTVSACTSGSSSSPTIISPTVTSST
Ga0099795_1006469933300007788Vadose Zone SoilMKVRGTTAGTPFGTRLTALCWAALALLGPVAVSACTSSSSTPTIISPTL
Ga0105240_1102069113300009093Corn RhizosphereMKVRGATTGTPFGARLTVLCWGALTLLAPVAVSACTSSSSTTTPTVFS
Ga0116218_115782213300009522Peatlands SoilMKVCTTFAGTALRARLTALCWGALTLLAPVAVSACSGSSTSPTIPTFT
Ga0116215_149551923300009672Peatlands SoilMKVCTTFAGTALRARLTALCWGALTLLAPVAVSACSGSST
Ga0116216_1090626113300009698Peatlands SoilMKVCTTFAGTALRARLTALCWGALTLLAPVAVSACSG
Ga0126374_1025009213300009792Tropical Forest SoilMKVRGATTGTPFGARLTALCWGALTLLVPVAVAACTSSPSTSTPTVFSPSVTSPGTG
Ga0126373_1243944423300010048Tropical Forest SoilMKVRGTTAGTPLSAKLIALCWGALTLLVPVAVSACTSSTTTTTP
Ga0137388_1017359513300012189Vadose Zone SoilMKVRRTTTATALGTRLTALCWGALTLIAPVAVSACTSG
Ga0137381_1029049913300012207Vadose Zone SoilMKGRGTTLGARLTALCWGALTLLAPVAVTACTSSS
Ga0137379_1020817213300012209Vadose Zone SoilMKVRRTTMAMALGTRLTALCWGALTLIAPVAVSACTSGSSTP
Ga0137377_1053277023300012211Vadose Zone SoilMKVRGTTAGTPFGAKLTALCWGALTLLAPVAISACT
Ga0137372_1030646623300012350Vadose Zone SoilMKVRGTIAGRPIGARLTALCWSALILLAPVAVSACTSSSSSTTPVFTPSVTTSA
Ga0157328_100266923300012478Arabidopsis RhizosphereMKVRGATTGTPFAARLTALCWGALTLLAPVAVSACTSSSSTTTPT
Ga0157319_100643713300012497Arabidopsis RhizosphereMKVRGTTLGVKLTALCWGALTLLAPVALAACTSSPSTTAPTVPTF
Ga0137404_1035660813300012929Vadose Zone SoilMKVRGTTAGTPFGARLTALCWGALTLLAPVAVSACTSSSSSTTRTIISPTVTN
Ga0164301_1052795713300012960SoilMKVRGATTGTPFAARLTALCWGALTLLAPVAISACTSSSST
Ga0164301_1081775813300012960SoilMKVRGTTAGTPFGAKLTALCWGALTLLAPVTVSACTSGSSSSPTII*
Ga0157376_1173307013300014969Miscanthus RhizosphereMKVRGTTAGTPFGAKLTALCWGALTLLAPVAVSACTSGSSSSP
Ga0132256_10318546123300015372Arabidopsis RhizosphereMKVRGATAGTPFGARLTALCWGALTLLVPVAVSACTSSSS
Ga0182033_1106427123300016319SoilMKVRGTIAGTPLSAKLTVLCWGVLTLLVPLAVSACTSGT
Ga0182037_1113044423300016404SoilMKVRGTIAGTPLSAKLTVLCWGALTLLVPMAVSACTSG
Ga0187779_1004112613300017959Tropical PeatlandMKVRTTTGGTPLGARLTVVCWGALTLLVPVTVSACSG
Ga0187766_1013970733300018058Tropical PeatlandMKVRITIPGTALGARLTALCWGALTLVALVAVSACSGSSTSSPGVP
Ga0187769_1118753423300018086Tropical PeatlandMKVRIAIPGTALGARLTALCWGALTLVALVAVSACSGSSSTPTVPTFSPSVTISGSGTATAP
Ga0193728_113800713300019890SoilMKVRGATTSTPFGARLTALCWGALTLLAPVAVSAC
Ga0210395_1079684323300020582SoilMKVRTTIAGTAFRAKLTALCWGALTILAPVAVSACSGSTSTPTVPNLSPTLI
Ga0210401_1027028233300020583SoilMKVRGTTAGTPFGAKLTALCWGALTLLAPVAVSACTSGSSSSPTIISPTV
Ga0210405_1025164413300021171SoilMKLRGTTAGTPFGAKLTALCWAALTLFAPVALSACTSSSPTTPTIISPTLTNS
Ga0210388_1024381113300021181SoilMKVRTTRAGTALGARLTAICWGALVLLALATVSACSGGSSSTPNVPSPPTSVTSPG
Ga0210383_1167280413300021407SoilMKVRTTIAGTALRARLTALCWGALIILAPLAVSACSGSTSTPTVPSFS
Ga0210384_1140317913300021432SoilMKVRTTIAGAAFRAKLTAVCWGALTILAPVAVSACSGSTSTPTVPNLS
Ga0210390_1115654323300021474SoilMKVRTTRAGTALGARLTAICWGALVLLALATVSACSGSGSTAPNI
Ga0210402_1093489223300021478SoilMKVRTTRAGTALGARLTAICWGALALLALATVSACSGSAS
Ga0247691_102529323300024222SoilMKVRGATTGTPFAARLTALCWGALTLLAPVAISACTSSS
Ga0224572_101477713300024225RhizosphereMKVRTTIAGTAFRAKLTAVCWGALTILAPVAVSAYDGST
Ga0247677_100302143300024245SoilMKVRGATTGTPFAARLTALCWGALALLAPVAISACTSSSSTTTPTIISPTVT
Ga0207652_1173009323300025921Corn RhizosphereMKVRGTTLGVKLTALCWGTLTLLAPVALAACSSSSPTAP
Ga0207700_1013374133300025928Corn, Switchgrass And Miscanthus RhizosphereMKVRGTTAGTPFGAKLTALCWGALTLLVPVAVSVMACPSLPA
Ga0207664_1120191213300025929Agricultural SoilMKVRGTTAGTPFGAKLTALCWGALTLLAPVAVSACTSSSST
Ga0207686_1005274913300025934Miscanthus RhizosphereMKVRGATTGTPFAARLTALCWGALALLAPVAISACTSSSST
Ga0207668_1107441623300025972Switchgrass RhizosphereMKVRGATTGTPFGARLTVLCWGALTLLAPVAVSACTSSSSTTT
Ga0179587_1021167413300026557Vadose Zone SoilMKVRGTTAGTPFGTRLTALCWAALAMLGPVAVSACTSSSSTPTIISPTLTN
Ga0208565_117450313300027662Peatlands SoilMKVCTTFAGTALRARLTALCWGALTLLAPVAVSACSGSSTSPTIPTFTPSV
Ga0208565_118675113300027662Peatlands SoilMKVRTTIAGTALRARLTALCWGALTLLVLVAVSACSGSSTSPTIPTFTPSV
Ga0208696_119853213300027696Peatlands SoilMKVRTTIAGTALRARVTALCWGALTLLAPVAVSACSGSSTSPTIPTFTPSVSISGTAT
Ga0209178_114703013300027725Agricultural SoilMKVRGTTAGTPFGAKLTALCWGALTLLAPITVSACT
Ga0209656_1014576943300027812Bog Forest SoilMKVRTTIAGTALRARLTALCWGTLTLLAPVAVSACSGSSSSPTIPTF
Ga0209067_1040507013300027898WatershedsMKVQTTIAGTALRARLTALCWGALIILAPVAVSACSG
Ga0247675_100202853300028072SoilMKVRGATTGTPFAARLTALCWGALALLAPVAISACTSSSSTTTPTIISP
Ga0307317_1005259833300028720SoilMKVRGATTGTPFGARLTALCWGALTLLAPVAVSACTSSSST
Ga0308309_1102576323300028906SoilMKVRTTIAGTAFRARLTALCWGALTMLAPVAVSACSGSSST
Ga0310037_1010517923300030494Peatlands SoilMKLRMAVARTTFAARLTALGWGALTLLVPVAVSACSGSSS
Ga0318541_1077058913300031545SoilMKVRGTIAGTPLSARLTALCWAALTLLVPVAVSACTSGTTST
Ga0318538_1011411613300031546SoilMKVRGKIAGTPLGARLTALCWGALTLLAPVAVSACSSSTSTPQVFSPSVTTGTATGTA
Ga0318515_1009821813300031572SoilMKVRGTIAGTPLSAKLTVLCWGALTLLVPMAVSACTSGTT
Ga0318542_1016965523300031668SoilMKVRGKIAGTPLGARLTALCWGALTLLAPVAVSACSSSTSTPQVFSPSVTTGTAT
Ga0318574_1073281023300031680SoilMKVRGTIASTPLSATLTALCWGALALLAPVALSACTSSTST
Ga0318572_1081385423300031681SoilMKVRITIPGTALGTRLTALCWGALTLVALVTVSACSSPSR
Ga0307474_1121610013300031718Hardwood Forest SoilMKVRGTTAGTPFGAKLTALCWGALTLLAPVAVSACTSSSSTSPT
Ga0306917_1121353513300031719SoilMKVRGTIASTPFSAKLTALCWGALTLLVPLAVSACT
Ga0307469_1212318113300031720Hardwood Forest SoilMKVRGTLTGRPLGARLTALGWAALILLAPVAVSACT
Ga0318494_1081169113300031751SoilMKVRRRTSGTPFRARLTALCWGALTLLAPAAVTACSGSGTTTPTISVSVTTP
Ga0318554_1070487713300031765SoilMKVRGTIAGTPLSARLTALCWAALTLLVPVAVSACTSGTTSTPPTSFSP
Ga0318521_1016019533300031770SoilMKVRGTIASTPLSATLTALCWGALALLAPVALSACTSSTSTTPPT
Ga0318543_1048848823300031777SoilMKVRGKIAGTPLGARLTALCWGALTLLAPVAVSACSSSTSTPQVFSPSVTT
Ga0318508_118284513300031780SoilMKVRGKIAGTPLGARLTALCWGALTLLAPVAVSACSSSTSTPQVFSPSVTTG
Ga0318568_1018641533300031819SoilMKVRGTIAGTPLSAKLTVLCWGALTLLVPMAVSACTSGTTSSAPPVFSPTVT
Ga0318517_1018792813300031835SoilMKVRGKIAGTPLGARLTALCWGALTLLAPVAVSACSSSTSTPQVFSPSVTTGTA
Ga0318511_1045408323300031845SoilMKVRGKIAGTPLGARLTALCWGALTLLAPVAVSACSSSTST
Ga0318544_1014595923300031880SoilMKVRGTIAGTPLSAKLTVLCWGALTLLVPMAVSACTSGTTSSAPPVFSPTVTTGTAAT
Ga0318520_1067598413300031897SoilMKVRGTIASTPLSATLTALCWGALALLAPVALSACTSST
Ga0306921_1038185643300031912SoilMKVRVTIAGTALGARLTALCWSALTLIAPLAAVSACSGASSSTPTVPTFT
Ga0318562_1046452513300032008SoilMKVRGTIASTPLSATLTALCWGALALLAPVALSACTSSTS
Ga0318563_1046690913300032009SoilMKVRGTIAGTPFSAKLTALCWGALTLLVPLAVSACTSSTSTAPPTIISPTVT
Ga0318504_1042561323300032063SoilMKVRVTIAGTAISARMTVLCWGALTLLAPMTVSACSGSSSTPTVPTFSPSVNTT
Ga0318510_1041720013300032064SoilMKVRGKIAGTPLGARLTALCWGALTLLAPVAVSACSSSTSTPQVFS
Ga0318513_1047430013300032065SoilMKVRVTIAGTALGARLTALCWSALTLIAPLAAVSACSGGSSSSPTVPTFTATVTGSSPA
Ga0306924_1143567323300032076SoilMKVRVPIARTAFRARMTALCWGALIVLAPMAVSACSGSSSSPTVPTFSPSVNTSTPVPAS
Ga0318540_1020487913300032094SoilMKVRGTIAGTPLSAKLTVLCWGALTLLVPMAVSACTSGTTSSAPPVFS
Ga0311301_1067795413300032160Peatlands SoilMKVRTTLFAGTALRARLTALCWGALTLLVPVAVSACSGSSTSPTIPTFTPSVTISGTAAGSGTAP
Ga0307472_10095300813300032205Hardwood Forest SoilMKVRGTIGGTPFSAKLTALCWGALTLFVPVAVSACTSSSSPTT
Ga0335085_1063948713300032770SoilMKVRGTIAGTPFGAKLTALGWAALTLLVPVAVSACTSSSSPTTPTVTFSP
Ga0335082_1044729713300032782SoilMKVRVTIAGTALGARLTALCWGALTLLVPLAVSACSGGSSSTP
Ga0335072_1171232423300032898SoilMKVRGTTLGVRLTALCWGALGLLAPVALAACTSSS
Ga0335076_1085472313300032955SoilMKLRSTTAGTVLGARLTAVCWGALTLLVPAAVAACSSNSTSTPTVPTF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.