


| Basic Information | |
|---|---|
| Family ID | F101488 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MAELQNEIFQEAMDTGLVNLEKRKQLLKYKEHLKNL |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 4.90 % |
| % of genes near scaffold ends (potentially truncated) | 67.65 % |
| % of genes from short scaffolds (< 2000 bps) | 86.27 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (68.627 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (20.588 % of family members) |
| Environment Ontology (ENVO) | Unclassified (67.647 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (80.392 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.31% β-sheet: 0.00% Coil/Unstructured: 54.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF14743 | DNA_ligase_OB_2 | 7.84 |
| PF04542 | Sigma70_r2 | 7.84 |
| PF02796 | HTH_7 | 6.86 |
| PF08279 | HTH_11 | 5.88 |
| PF04404 | ERF | 3.92 |
| PF13662 | Toprim_4 | 0.98 |
| PF12684 | DUF3799 | 0.98 |
| PF03819 | MazG | 0.98 |
| PF03061 | 4HBT | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 7.84 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 7.84 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 7.84 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 7.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 68.63 % |
| All Organisms | root | All Organisms | 31.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10050989 | All Organisms → Viruses → Predicted Viral | 2067 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10026596 | All Organisms → Viruses → Predicted Viral | 2897 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10212357 | Not Available | 588 | Open in IMG/M |
| 3300001450|JGI24006J15134_10047866 | All Organisms → Viruses → Predicted Viral | 1768 | Open in IMG/M |
| 3300001450|JGI24006J15134_10050965 | All Organisms → Viruses → Predicted Viral | 1691 | Open in IMG/M |
| 3300001460|JGI24003J15210_10028906 | Not Available | 2034 | Open in IMG/M |
| 3300001460|JGI24003J15210_10041516 | Not Available | 1593 | Open in IMG/M |
| 3300001460|JGI24003J15210_10050621 | All Organisms → Viruses → Predicted Viral | 1388 | Open in IMG/M |
| 3300001472|JGI24004J15324_10034119 | Not Available | 1625 | Open in IMG/M |
| 3300001589|JGI24005J15628_10038248 | Not Available | 1945 | Open in IMG/M |
| 3300001589|JGI24005J15628_10176287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300004457|Ga0066224_1002552 | Not Available | 1567 | Open in IMG/M |
| 3300006191|Ga0075447_10042542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1703 | Open in IMG/M |
| 3300006749|Ga0098042_1137405 | Not Available | 604 | Open in IMG/M |
| 3300006789|Ga0098054_1298459 | Not Available | 576 | Open in IMG/M |
| 3300006922|Ga0098045_1027290 | Not Available | 1488 | Open in IMG/M |
| 3300006947|Ga0075444_10063518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1703 | Open in IMG/M |
| 3300006947|Ga0075444_10228437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 740 | Open in IMG/M |
| 3300007276|Ga0070747_1166729 | Not Available | 787 | Open in IMG/M |
| 3300007276|Ga0070747_1220686 | Not Available | 664 | Open in IMG/M |
| 3300007344|Ga0070745_1191230 | Not Available | 759 | Open in IMG/M |
| 3300007559|Ga0102828_1091282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 736 | Open in IMG/M |
| 3300007956|Ga0105741_1084393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 776 | Open in IMG/M |
| 3300007957|Ga0105742_1037013 | Not Available | 634 | Open in IMG/M |
| 3300007992|Ga0105748_10099626 | Not Available | 1161 | Open in IMG/M |
| 3300009425|Ga0114997_10568506 | Not Available | 599 | Open in IMG/M |
| 3300009428|Ga0114915_1096296 | Not Available | 885 | Open in IMG/M |
| 3300009433|Ga0115545_1193219 | Not Available | 696 | Open in IMG/M |
| 3300009436|Ga0115008_10578850 | Not Available | 807 | Open in IMG/M |
| 3300009445|Ga0115553_1394198 | Not Available | 527 | Open in IMG/M |
| 3300009467|Ga0115565_10287503 | Not Available | 749 | Open in IMG/M |
| 3300009512|Ga0115003_10157610 | Not Available | 1377 | Open in IMG/M |
| 3300009608|Ga0115100_10714924 | Not Available | 3175 | Open in IMG/M |
| 3300009785|Ga0115001_10104287 | Not Available | 1857 | Open in IMG/M |
| 3300010149|Ga0098049_1181656 | Not Available | 647 | Open in IMG/M |
| 3300010150|Ga0098056_1054405 | All Organisms → Viruses → Predicted Viral | 1382 | Open in IMG/M |
| 3300010392|Ga0118731_103653840 | Not Available | 1380 | Open in IMG/M |
| 3300010392|Ga0118731_108685982 | Not Available | 1263 | Open in IMG/M |
| 3300010392|Ga0118731_110820690 | Not Available | 792 | Open in IMG/M |
| 3300010392|Ga0118731_111756360 | Not Available | 1765 | Open in IMG/M |
| 3300010392|Ga0118731_112928072 | Not Available | 500 | Open in IMG/M |
| 3300010430|Ga0118733_103054667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 917 | Open in IMG/M |
| 3300011118|Ga0114922_11577173 | Not Available | 527 | Open in IMG/M |
| 3300012920|Ga0160423_10600385 | Not Available | 746 | Open in IMG/M |
| 3300017713|Ga0181391_1107005 | Not Available | 630 | Open in IMG/M |
| 3300017714|Ga0181412_1027057 | Not Available | 1563 | Open in IMG/M |
| 3300017725|Ga0181398_1081042 | Not Available | 777 | Open in IMG/M |
| 3300017744|Ga0181397_1035674 | Not Available | 1413 | Open in IMG/M |
| 3300017746|Ga0181389_1100143 | Not Available | 799 | Open in IMG/M |
| 3300017762|Ga0181422_1161401 | Not Available | 685 | Open in IMG/M |
| 3300017762|Ga0181422_1179808 | Not Available | 643 | Open in IMG/M |
| 3300017771|Ga0181425_1046937 | Not Available | 1409 | Open in IMG/M |
| 3300017782|Ga0181380_1024922 | Not Available | 2213 | Open in IMG/M |
| 3300017783|Ga0181379_1169292 | Not Available | 773 | Open in IMG/M |
| 3300020457|Ga0211643_10545963 | Not Available | 569 | Open in IMG/M |
| 3300020469|Ga0211577_10451397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 787 | Open in IMG/M |
| 3300021335|Ga0213867_1014968 | Not Available | 3225 | Open in IMG/M |
| 3300021347|Ga0213862_10317173 | Not Available | 554 | Open in IMG/M |
| 3300022061|Ga0212023_1037309 | Not Available | 676 | Open in IMG/M |
| 3300022067|Ga0196895_1037603 | Not Available | 556 | Open in IMG/M |
| 3300022068|Ga0212021_1069949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 719 | Open in IMG/M |
| 3300022167|Ga0212020_1023425 | Not Available | 1010 | Open in IMG/M |
| 3300022178|Ga0196887_1137293 | Not Available | 511 | Open in IMG/M |
| 3300022200|Ga0196901_1250147 | Not Available | 550 | Open in IMG/M |
| (restricted) 3300022938|Ga0233409_10205061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 666 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10080146 | Not Available | 1910 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10012948 | All Organisms → Viruses | 3335 | Open in IMG/M |
| (restricted) 3300024052|Ga0255050_10085324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 713 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10376394 | Not Available | 612 | Open in IMG/M |
| 3300024229|Ga0233402_1071794 | Not Available | 726 | Open in IMG/M |
| 3300024236|Ga0228655_1087536 | Not Available | 673 | Open in IMG/M |
| 3300024237|Ga0228653_1103089 | Not Available | 609 | Open in IMG/M |
| 3300024297|Ga0228658_1003328 | All Organisms → Viruses | 4469 | Open in IMG/M |
| 3300024297|Ga0228658_1118340 | Not Available | 646 | Open in IMG/M |
| 3300024334|Ga0228671_1047387 | Not Available | 1144 | Open in IMG/M |
| (restricted) 3300024340|Ga0255042_10066400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 944 | Open in IMG/M |
| 3300024346|Ga0244775_10260097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1445 | Open in IMG/M |
| 3300024428|Ga0233396_1088270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 766 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10423571 | Not Available | 644 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10066855 | Not Available | 1455 | Open in IMG/M |
| 3300025120|Ga0209535_1012657 | All Organisms → Viruses → Predicted Viral | 4630 | Open in IMG/M |
| 3300025138|Ga0209634_1183869 | Not Available | 817 | Open in IMG/M |
| 3300025168|Ga0209337_1074102 | Not Available | 1673 | Open in IMG/M |
| 3300025276|Ga0208814_1131284 | Not Available | 587 | Open in IMG/M |
| 3300025816|Ga0209193_1015079 | All Organisms → Viruses | 2558 | Open in IMG/M |
| 3300026505|Ga0228647_1039892 | All Organisms → Viruses | 1203 | Open in IMG/M |
| 3300026517|Ga0228607_1109939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300027186|Ga0208797_1027314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 752 | Open in IMG/M |
| 3300027668|Ga0209482_1060248 | Not Available | 1342 | Open in IMG/M |
| 3300027704|Ga0209816_1174246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 740 | Open in IMG/M |
| 3300027820|Ga0209578_10301651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300027858|Ga0209013_10433022 | Not Available | 721 | Open in IMG/M |
| 3300027906|Ga0209404_10382147 | Not Available | 914 | Open in IMG/M |
| 3300028008|Ga0228674_1046688 | All Organisms → Viruses → Predicted Viral | 1658 | Open in IMG/M |
| 3300028136|Ga0228608_1017053 | All Organisms → Viruses → Predicted Viral | 2140 | Open in IMG/M |
| 3300028194|Ga0257106_1045211 | Not Available | 1680 | Open in IMG/M |
| 3300028297|Ga0228617_1005720 | Not Available | 5056 | Open in IMG/M |
| 3300028418|Ga0228615_1190015 | Not Available | 508 | Open in IMG/M |
| 3300029448|Ga0183755_1052409 | Not Available | 1016 | Open in IMG/M |
| 3300033742|Ga0314858_171255 | Not Available | 558 | Open in IMG/M |
| 3300034374|Ga0348335_002457 | Not Available | 12784 | Open in IMG/M |
| 3300034374|Ga0348335_037587 | All Organisms → Viruses → Predicted Viral | 2026 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 20.59% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 14.71% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 12.75% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.78% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 8.82% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 4.90% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 4.90% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.92% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.94% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.94% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.96% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.96% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.96% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.98% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.98% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.98% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.98% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.98% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.98% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007956 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2um | Environmental | Open in IMG/M |
| 3300007957 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_3.0um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009608 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022938 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024052 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5 | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024229 | Seawater microbial communities from Monterey Bay, California, United States - 54D | Environmental | Open in IMG/M |
| 3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
| 3300024237 | Seawater microbial communities from Monterey Bay, California, United States - 65D | Environmental | Open in IMG/M |
| 3300024297 | Seawater microbial communities from Monterey Bay, California, United States - 71D | Environmental | Open in IMG/M |
| 3300024334 | Seawater microbial communities from Monterey Bay, California, United States - 89D | Environmental | Open in IMG/M |
| 3300024340 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024428 | Seawater microbial communities from Monterey Bay, California, United States - 32D | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300026505 | Seawater microbial communities from Monterey Bay, California, United States - 59D | Environmental | Open in IMG/M |
| 3300026517 | Seawater microbial communities from Monterey Bay, California, United States - 8D | Environmental | Open in IMG/M |
| 3300027186 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028136 | Seawater microbial communities from Monterey Bay, California, United States - 9D | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028297 | Seawater microbial communities from Monterey Bay, California, United States - 18D | Environmental | Open in IMG/M |
| 3300028418 | Seawater microbial communities from Monterey Bay, California, United States - 16D | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100509894 | 3300000101 | Marine | MQELQNEIFQEAMDTGLVNLEKRKQLLKYKNHLKHI* |
| DelMOWin2010_100265964 | 3300000117 | Marine | MAQLQNELCQEAINTGIVNLEKRQQLLKYKEHLKHL* |
| DelMOWin2010_102123572 | 3300000117 | Marine | MQELQNELFQEAMDTGLVNLEKRKQLLKYKNHLKHI* |
| JGI24006J15134_100478663 | 3300001450 | Marine | MAELSNEIFEDAIATGKVNLEKRQQLLKYKEYLKHL* |
| JGI24006J15134_100509651 | 3300001450 | Marine | AELSSEIFEDAIATGIVNLEKRKQLLKYRTHLKHL* |
| JGI24003J15210_100289066 | 3300001460 | Marine | KRYVSQRMSELQNEIFQDAMATGLVNLEKRKQLLKYKEHLKNL* |
| JGI24003J15210_100415164 | 3300001460 | Marine | ELSNEIFEDAIATGIVNLEKRKQLLKYRTHLKNL* |
| JGI24003J15210_100506211 | 3300001460 | Marine | HRMAELSSEIFEDAIATGIVNLEKRKQLLKYRTHLKXL* |
| JGI24004J15324_100341191 | 3300001472 | Marine | MAELQTEIFNDAMATGIVNLEKRQQLLKYRTHLNNL* |
| JGI24005J15628_100382485 | 3300001589 | Marine | EHRMAELSNEIFEDAIATGIVNLEKRKQLLKYRTHLKHL* |
| JGI24005J15628_101762871 | 3300001589 | Marine | YVEHRMAELSSEIFEDAIATGIVNLEKRQQLLKYKTHLKHL* |
| Ga0066224_10025524 | 3300004457 | Marine | HRRYVTHRMAELSNEIFEDAMATGKVNLEKRQQLLKYKQHLKHL* |
| Ga0075447_100425424 | 3300006191 | Marine | RMAELSNEIFEDAIATGKVNLEKRQQLLKYRTHLKNL* |
| Ga0098042_11374051 | 3300006749 | Marine | QRMAQLQNELCQEAIQTGKVNLEKRQQLLKYKEHLKNL* |
| Ga0098054_12984591 | 3300006789 | Marine | MAQLQNELCQEAINTGKVNLEKRQQLLKYKEHLRNL |
| Ga0098045_10272905 | 3300006922 | Marine | MAQLQNELCQEAINTGKVNLEKRQQLLKYRTHLKNL* |
| Ga0075444_100635184 | 3300006947 | Marine | YVTHRMAELSNEIFEDAIATGKVNLEKRQQLLKYRTHLKNL* |
| Ga0075444_102284373 | 3300006947 | Marine | FLHRIYVSQRMSELQQEIFRDCMATGKVNLEKRDQLLKYKEHLKNL* |
| Ga0070747_11667294 | 3300007276 | Aqueous | MQELQNEIFQEAMDTGLVNLEKRKQLLKYKNHLKH |
| Ga0070747_12206862 | 3300007276 | Aqueous | MAELQNEIFQEAIDTGLVNMEKRKQLLKYKEHLKNL* |
| Ga0070745_11912303 | 3300007344 | Aqueous | MQELQNEIFKDAMATGIVNLEKRKQLLKYKEHLKNL* |
| Ga0102828_10912821 | 3300007559 | Estuarine | AELSNEIFEDAIATGKVNLEKRKQLLKYKEHLKNL* |
| Ga0105741_10843931 | 3300007956 | Estuary Water | MFHKRYVTKRMAELQSEIFHDAMETGLVNLEKRKQLLKYRTHLKNL* |
| Ga0105742_10370131 | 3300007957 | Estuary Water | YVTKRMAELQNEIFADAMATGIVNLEKRKQLLKYRTHLKNL* |
| Ga0105748_100996261 | 3300007992 | Estuary Water | HRRYVEHRMAELSSEIFEDAIANGIVNLEKRKQLLKYRTHLKHL* |
| Ga0114997_105685061 | 3300009425 | Marine | MAELSNEIFEDAMATGKVNLEKRQQLLKYKHHLKHL* |
| Ga0114915_10962963 | 3300009428 | Deep Ocean | MAELQMELCNEAIATGKVNLEKRQQLLKYKTHIQYL* |
| Ga0115545_11932193 | 3300009433 | Pelagic Marine | RMAQLQTEIFNDAMATGKVNLEKRQQLLKYRTHLNNL* |
| Ga0115008_105788502 | 3300009436 | Marine | MAELQNEIFQDAMATGKVNLEKRQQLLKYKEHLRNL* |
| Ga0115553_13941981 | 3300009445 | Pelagic Marine | QLQNELCQEAINTGKVNLEKRKQLLKYKNHLKHL* |
| Ga0115565_102875032 | 3300009467 | Pelagic Marine | MAELSNEIFEDAIATGKVNLEKRKQLLKYKEHLRNL* |
| Ga0115003_101576101 | 3300009512 | Marine | YVTHRMAELSNEIFEDAMATGKVNLEKRQQLLKYKQHLKYLNGGK* |
| Ga0115100_107149248 | 3300009608 | Marine | VEHRMAQLQTEIFNDAMATGVVNLEKRQQLLKYRTHLNNL* |
| Ga0115001_101042871 | 3300009785 | Marine | RKYVTHRMAELSNEIFEDAMATGKVNLEKRQQLLKYKHHLKHL* |
| Ga0098049_11816563 | 3300010149 | Marine | HKRYVTKRMAELSNEILHEALSTGKVNLEKRKQLLKYKDYLKNL* |
| Ga0098056_10544055 | 3300010150 | Marine | MQELQNEIFQEAMDTGLVNMEKRKQLLKYKNHLKNL* |
| Ga0118731_1036538404 | 3300010392 | Marine | MAELQNEIFTDAMATGIVNLEKRQQLLKYKEHLKNL* |
| Ga0118731_1086859821 | 3300010392 | Marine | VTHRMAELSNEIFEDAMATGKVNLEKRQQLLKYKEHLKHL* |
| Ga0118731_1108206901 | 3300010392 | Marine | MQELQNEIFKDAMATGIVNLEKRKQLLKYKEHLRNL* |
| Ga0118731_1117563601 | 3300010392 | Marine | VEYRMAQLQTEIFNDAMATGKVNLEKRQQLLKYRTHLNNL* |
| Ga0118731_1129280723 | 3300010392 | Marine | HRMAELSNEIFEDAIATGKVNLEKRKQLLKYKEHLRNL* |
| Ga0118733_1030546671 | 3300010430 | Marine Sediment | MAELSNEIFEDAMATGKVDLGKRQQLLKYKEHLKHL* |
| Ga0114922_115771733 | 3300011118 | Deep Subsurface | FLHRVYVSKRMSELQQEIFRDCMATGKVNLEKRQQLLKYKEHLKNL* |
| Ga0160423_106003852 | 3300012920 | Surface Seawater | MAELQNEIFQEAMDTGLVNLEKRKQLLKYKEHLRNL* |
| Ga0181391_11070051 | 3300017713 | Seawater | AQLQTEIFNDAMATGKVNLEKRQQLLKYRTHLNNL |
| Ga0181412_10270571 | 3300017714 | Seawater | EHRMAQLQTEIFNDAMATGVVNLEKRQQLLKYRTHLNNL |
| Ga0181398_10810423 | 3300017725 | Seawater | MAELSSEIFEDAMATGKVNLEKRKQLLKYKEHLRNLXQTKQNQY |
| Ga0181397_10356745 | 3300017744 | Seawater | HKRYVSHRMQELQNEIFQEAIDTGLVNMDKRKQLLKYKNHLKNL |
| Ga0181389_11001433 | 3300017746 | Seawater | SYRMQELQNEIFQEAMDTGLVNLEKRKQLLKYKNHLKFL |
| Ga0181422_11614012 | 3300017762 | Seawater | MQELQNEIFQEAMDTGLVNLEKRKQLLKYKNHLKHIXKTL |
| Ga0181422_11798081 | 3300017762 | Seawater | KRMAQLQTEIFNDAMATGKVNLEKRQQLLKYRTHLNNL |
| Ga0181425_10469373 | 3300017771 | Seawater | MQELQNEIFKEAMDTGLVNMEKRKQLLKYKNHLKHI |
| Ga0181380_10249221 | 3300017782 | Seawater | MQELQNEIFQEAIDTGLVNMEKRKQLLKYKNHLKNL |
| Ga0181379_11692923 | 3300017783 | Seawater | MAELQNEIFQEAMDTGLVNLEKRKQLLKYKEHLKNL |
| Ga0211643_105459633 | 3300020457 | Marine | RMAQLQNELCQEAIDTGIVNLEKRQQLLKYKEHLKHL |
| Ga0211577_104513973 | 3300020469 | Marine | VAQRMAQLQNELCQEAINTGIVNLEKRKQLLKYKEHLRNL |
| Ga0213867_10149686 | 3300021335 | Seawater | MQELQNEIFQEAMDTGLVNLEKRKQLLKYKNHLKYI |
| Ga0213862_103171732 | 3300021347 | Seawater | MQELQNEIFQEAMDTGLVNMDKRKQLLKYKNHLKYL |
| Ga0212023_10373092 | 3300022061 | Aqueous | MQELQNELFQEAMDTGLVNLEKRKQLLKYKNHLKHI |
| Ga0196895_10376033 | 3300022067 | Aqueous | YRMQELQNEIFQEAIDTGLVNMDKRKQLLKYKEHLRNL |
| Ga0212021_10699491 | 3300022068 | Aqueous | SELQNEIFQEAMDTGLVNLEKRKQLLKYKEHLRNL |
| Ga0212020_10234254 | 3300022167 | Aqueous | MAQLQNEIFQEAIDTGLVNLEKRKQLLKYKEHLKNL |
| Ga0196887_11372933 | 3300022178 | Aqueous | AYRMQELQNEIFQEAIDTGLVNMDKRKQLLKYKEHLRNL |
| Ga0196901_12501473 | 3300022200 | Aqueous | HKRYVSYRMQELQNEIFQEAMDTGLVNLEKRKQLLKYKNHLKHI |
| (restricted) Ga0233409_102050611 | 3300022938 | Seawater | YVAQRMAELQNEIFQEAIDTGLVNMEKRKQLLKYKEHLKNL |
| (restricted) Ga0233432_100801462 | 3300023109 | Seawater | MQELQSEIFQEAIDTGLVNMEKRKQLLKYKEHLRNL |
| (restricted) Ga0233412_100129481 | 3300023210 | Seawater | HKRYVSHRMQELQNEIFQEAIDTGLVNMDKRKQLLKYKEHLRNL |
| (restricted) Ga0255050_100853243 | 3300024052 | Seawater | MAELQNEIFQEAIDTGLVNMEKRKQLLKYKEHLKNL |
| (restricted) Ga0255039_103763941 | 3300024062 | Seawater | HRMAQLQTEIFNDAMATGVVNLEKRKQLLKYRTHLNNL |
| Ga0233402_10717943 | 3300024229 | Seawater | RYVSYRMQELQNEIFQEAMDTGLVNLEKRKQLLKYKNHLKFL |
| Ga0228655_10875361 | 3300024236 | Seawater | MQELQNEIFQEAMDTGLVNLEKRKQLLKYKNHLKF |
| Ga0228653_11030893 | 3300024237 | Seawater | AELQNEIFQEAMDTGLVNLEKRKQLLKYKEHLKNL |
| Ga0228658_10033284 | 3300024297 | Seawater | MQELQNEIFQEAMDTGLVNLEKRKQLLKYKNHLKFL |
| Ga0228658_11183401 | 3300024297 | Seawater | YVEHRMAQLQTEIFNDAMATGKVNLEKRQQLLKYRTHLNNL |
| Ga0228671_10473873 | 3300024334 | Seawater | MQELQNEIFQEAMDTGLVNLEKRKQLLKYKNHLKHI |
| (restricted) Ga0255042_100664003 | 3300024340 | Seawater | RHKRYVAQRMAELQSELCQEAINTGKVNLEKRQQLLKYKEHIRNL |
| Ga0244775_102600975 | 3300024346 | Estuarine | QMAEIQNEIFADAMATGIVNLEKRKQLLKYKEHLKNL |
| Ga0233396_10882703 | 3300024428 | Seawater | SHRKYVTKRMAELQNEIFADAMATGIVNLEKRKQLLKYKEHLKNL |
| (restricted) Ga0255048_104235711 | 3300024518 | Seawater | HKRYVSHRMQELQNEIFQEAMDTGLVNMDKRKQLLKYKNHLKHL |
| (restricted) Ga0255046_100668555 | 3300024519 | Seawater | HRRYVAQRMAELQNEIFQEAIDTGLVNMEKRKQLLKYKEHLKNL |
| Ga0209535_10126579 | 3300025120 | Marine | RRYVEHRMAELSSEIFEDAIATGIVNLEKRKQLLKYRTHLKHL |
| Ga0209634_11838691 | 3300025138 | Marine | VEHRMAELSSEIFEDAIATGIVNLEKRKQLLKYRTHLKHL |
| Ga0209337_10741021 | 3300025168 | Marine | RYVEHRMAELQTEIFNDAMATGIVNLEKRQQLLKYRTHLNNL |
| Ga0208814_11312843 | 3300025276 | Deep Ocean | MSELQQEIFRDCMATGKVNLEKRDQLLKYKEHLKNL |
| Ga0209193_10150794 | 3300025816 | Pelagic Marine | MAQLQNELCQEAINTGKVNLEKRKQLLKYKNHLKHL |
| Ga0228647_10398922 | 3300026505 | Seawater | MAELQNEIFQDAMATGLVNMEKRKQLLKYKEHLRNL |
| Ga0228607_11099391 | 3300026517 | Seawater | MAQLQTEIFNDAMATGKVNLEKRQQLLKYRTHLNNL |
| Ga0208797_10273143 | 3300027186 | Estuarine | YVTHRMAELSNEIFEDAIATGKVNLEKRKQLLKYKEHLKNL |
| Ga0209482_10602485 | 3300027668 | Marine | MAELSNEIFEDAIATGKVNLEKRQQLLKYRTHLKNL |
| Ga0209816_11742463 | 3300027704 | Marine | FLHRIYVSQRMSELQQEIFRDCMATGKVNLEKRDQLLKYKEHLKNL |
| Ga0209578_103016511 | 3300027820 | Marine Sediment | RMAQLQTEIFNDAMATGKVNLEKRQQLLKYRTHLNHL |
| Ga0209013_104330221 | 3300027858 | Marine | KRYVSHRMQELQNEIFQEAIDTGLVNMEKRKQLLKYKEHLRNL |
| Ga0209404_103821472 | 3300027906 | Marine | MAQLQNELCQEAINTGIVNLEKRQQLLKYKEHLKNL |
| Ga0228674_10466884 | 3300028008 | Seawater | QELQNEIFQEAMDTGLVNLEKRKQLLKYKNHLKFL |
| Ga0228608_10170535 | 3300028136 | Seawater | YRMQELQNEIFQEAMDTGLVNLEKRKQLLKYKNHLKFL |
| Ga0257106_10452111 | 3300028194 | Marine | EHRMAELSSEIFEDAIATGIVNLEKRKQLLKYRTHLKHL |
| Ga0228617_10057201 | 3300028297 | Seawater | LSHRRYVAQRMAELQNEIFQEAIDTGLVNLEKRKQLLKYKE |
| Ga0228615_11900152 | 3300028418 | Seawater | MQELQNEIFQEAMDTGLVNLEKRKQLLKYKNHLKHIXKTLTGYYTKA |
| Ga0183755_10524091 | 3300029448 | Marine | KRYVAHRMQELQNEIFQEAMDTGLVNMEKRKQLLKYKNHLKYL |
| Ga0314858_171255_18_128 | 3300033742 | Sea-Ice Brine | MAELQTEIFNDAMATGKVNLEKRQQLLKYRTHLNHL |
| Ga0348335_002457_940_1050 | 3300034374 | Aqueous | MQELQNEIFQEAIDTGLVNMDKRKQLLKYKEHLRNL |
| Ga0348335_037587_1590_1700 | 3300034374 | Aqueous | MQELQNEIFKDAMATGIVNLEKRKQLLKYKEHLKNL |
| ⦗Top⦘ |