Basic Information | |
---|---|
Family ID | F101451 |
Family Type | Metagenome |
Number of Sequences | 102 |
Average Sequence Length | 43 residues |
Representative Sequence | MATDMVAYGIYPDRASFERTLEALRAAGFRNSDISAILPDRD |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 98.04 % |
% of genes from short scaffolds (< 2000 bps) | 97.06 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.61 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.588 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (12.745 % of family members) |
Environment Ontology (ENVO) | Unclassified (44.118 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.941 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.86% β-sheet: 11.43% Coil/Unstructured: 65.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF00072 | Response_reg | 10.78 |
PF13360 | PQQ_2 | 5.88 |
PF05532 | CsbD | 3.92 |
PF02518 | HATPase_c | 3.92 |
PF05163 | DinB | 2.94 |
PF01479 | S4 | 2.94 |
PF01436 | NHL | 1.96 |
PF00583 | Acetyltransf_1 | 1.96 |
PF00128 | Alpha-amylase | 1.96 |
PF13673 | Acetyltransf_10 | 1.96 |
PF07638 | Sigma70_ECF | 1.96 |
PF00069 | Pkinase | 1.96 |
PF07366 | SnoaL | 1.96 |
PF00849 | PseudoU_synth_2 | 1.96 |
PF08281 | Sigma70_r4_2 | 0.98 |
PF13793 | Pribosyltran_N | 0.98 |
PF13545 | HTH_Crp_2 | 0.98 |
PF11127 | DUF2892 | 0.98 |
PF06445 | GyrI-like | 0.98 |
PF04972 | BON | 0.98 |
PF08450 | SGL | 0.98 |
PF00749 | tRNA-synt_1c | 0.98 |
PF03965 | Penicillinase_R | 0.98 |
PF00224 | PK | 0.98 |
PF04214 | DUF411 | 0.98 |
PF02786 | CPSase_L_D2 | 0.98 |
PF13505 | OMP_b-brl | 0.98 |
PF00483 | NTP_transferase | 0.98 |
PF08447 | PAS_3 | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 7.84 |
COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 3.92 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.94 |
COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 1.96 |
COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 1.96 |
COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 1.96 |
COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 1.96 |
COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 1.96 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.96 |
COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 1.96 |
COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.98 |
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.98 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.98 |
COG3019 | Uncharacterized metal-binding protein, DUF411 family | Function unknown [S] | 0.98 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.98 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.98 |
COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 71.57 % |
Unclassified | root | N/A | 28.43 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886012|MBSR1b_contig_11683047 | Not Available | 814 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_13807132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Citrifermentans → Citrifermentans bemidjiense | 693 | Open in IMG/M |
3300000956|JGI10216J12902_107455275 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
3300004114|Ga0062593_100474924 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300004156|Ga0062589_101518012 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300004463|Ga0063356_102698286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
3300005093|Ga0062594_101869545 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300005093|Ga0062594_102024867 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300005335|Ga0070666_11404001 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300005336|Ga0070680_101761898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
3300005356|Ga0070674_100497415 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300005367|Ga0070667_100869549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 838 | Open in IMG/M |
3300005456|Ga0070678_100826655 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300005467|Ga0070706_101893949 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300005539|Ga0068853_101263264 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300005564|Ga0070664_100573408 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300005577|Ga0068857_100587140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1052 | Open in IMG/M |
3300005577|Ga0068857_102382588 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300005616|Ga0068852_101783300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
3300005617|Ga0068859_102097772 | Not Available | 624 | Open in IMG/M |
3300005618|Ga0068864_100467419 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300005718|Ga0068866_10808845 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300005764|Ga0066903_103698340 | Not Available | 823 | Open in IMG/M |
3300005834|Ga0068851_10369538 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300005834|Ga0068851_10792734 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300005937|Ga0081455_10273561 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
3300006196|Ga0075422_10330354 | Not Available | 660 | Open in IMG/M |
3300006844|Ga0075428_100296127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1740 | Open in IMG/M |
3300006847|Ga0075431_100719775 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300006853|Ga0075420_100045311 | All Organisms → cellular organisms → Bacteria | 3918 | Open in IMG/M |
3300006894|Ga0079215_10110681 | Not Available | 1231 | Open in IMG/M |
3300006914|Ga0075436_101148972 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300009094|Ga0111539_13279684 | Not Available | 521 | Open in IMG/M |
3300009100|Ga0075418_12260330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
3300009100|Ga0075418_13155918 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300009148|Ga0105243_11786039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 646 | Open in IMG/M |
3300009156|Ga0111538_12284305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
3300009553|Ga0105249_12330158 | Not Available | 608 | Open in IMG/M |
3300009609|Ga0105347_1334221 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300010040|Ga0126308_10563150 | Not Available | 775 | Open in IMG/M |
3300010047|Ga0126382_11846911 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300010047|Ga0126382_12281615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300010397|Ga0134124_12557416 | Not Available | 553 | Open in IMG/M |
3300010403|Ga0134123_11056379 | Not Available | 832 | Open in IMG/M |
3300011119|Ga0105246_12399917 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300011435|Ga0137426_1133256 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300012200|Ga0137382_11290126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300012916|Ga0157310_10166763 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 774 | Open in IMG/M |
3300012961|Ga0164302_11794526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 518 | Open in IMG/M |
3300012988|Ga0164306_10495078 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300012989|Ga0164305_10265118 | Not Available | 1249 | Open in IMG/M |
3300013297|Ga0157378_13049885 | Not Available | 520 | Open in IMG/M |
3300013306|Ga0163162_11319842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 820 | Open in IMG/M |
3300013308|Ga0157375_10923472 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300013308|Ga0157375_10973818 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300013308|Ga0157375_11540132 | Not Available | 785 | Open in IMG/M |
3300013308|Ga0157375_13206410 | Not Available | 545 | Open in IMG/M |
3300014255|Ga0075320_1103061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
3300014326|Ga0157380_12361407 | Not Available | 597 | Open in IMG/M |
3300014969|Ga0157376_11175604 | Not Available | 795 | Open in IMG/M |
3300015077|Ga0173483_10762321 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
3300015371|Ga0132258_10182359 | All Organisms → cellular organisms → Bacteria | 5075 | Open in IMG/M |
3300015374|Ga0132255_103517814 | Not Available | 666 | Open in IMG/M |
3300018031|Ga0184634_10156450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
3300018469|Ga0190270_11281738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 774 | Open in IMG/M |
3300019362|Ga0173479_10787736 | Not Available | 524 | Open in IMG/M |
3300023064|Ga0247801_1088505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300025908|Ga0207643_10496563 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300025925|Ga0207650_11006212 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300025926|Ga0207659_11492934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 578 | Open in IMG/M |
3300025940|Ga0207691_10087509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2795 | Open in IMG/M |
3300025942|Ga0207689_11473244 | Not Available | 569 | Open in IMG/M |
3300025961|Ga0207712_11007245 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 739 | Open in IMG/M |
3300025986|Ga0207658_11203127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
3300026089|Ga0207648_12057208 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300027821|Ga0209811_10097819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
3300027886|Ga0209486_10392084 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300027909|Ga0209382_11578741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
3300028380|Ga0268265_10432831 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
3300028380|Ga0268265_11051869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
3300028802|Ga0307503_10492324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 659 | Open in IMG/M |
3300028812|Ga0247825_10186251 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
3300028812|Ga0247825_10332767 | Not Available | 1065 | Open in IMG/M |
3300028812|Ga0247825_11462777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 501 | Open in IMG/M |
3300031229|Ga0299913_10657244 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
3300031547|Ga0310887_11126128 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300031731|Ga0307405_11600635 | Not Available | 575 | Open in IMG/M |
3300031740|Ga0307468_102528271 | Not Available | 503 | Open in IMG/M |
3300031847|Ga0310907_10642414 | Not Available | 582 | Open in IMG/M |
3300031908|Ga0310900_11413711 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300031911|Ga0307412_10691377 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300032000|Ga0310903_10621073 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300032012|Ga0310902_10820469 | Not Available | 635 | Open in IMG/M |
3300032017|Ga0310899_10667364 | Not Available | 525 | Open in IMG/M |
3300032075|Ga0310890_10214752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1329 | Open in IMG/M |
3300032179|Ga0310889_10231727 | Not Available | 867 | Open in IMG/M |
3300032179|Ga0310889_10764449 | Not Available | 508 | Open in IMG/M |
3300033412|Ga0310810_11328753 | Not Available | 561 | Open in IMG/M |
3300033551|Ga0247830_11318998 | Not Available | 577 | Open in IMG/M |
3300034147|Ga0364925_0054877 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1360 | Open in IMG/M |
3300034148|Ga0364927_0012558 | All Organisms → cellular organisms → Bacteria | 1866 | Open in IMG/M |
3300034690|Ga0364923_0226959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 507 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 12.75% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.92% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.94% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.96% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.98% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.98% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.98% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.98% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.98% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.98% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014255 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
MBSR1b_0660.00004210 | 2162886012 | Miscanthus Rhizosphere | MATDMVAYGIYPDSESFQRALEALRSAGFRNSDVSAILPDRDRTGRDLAHE |
ICChiseqgaiiFebDRAFT_138071321 | 3300000363 | Soil | MTTDLVAYGIFTDRDSFEGALNALRAAGFRNSDISAVLPERDQT |
JGI10216J12902_1074552751 | 3300000956 | Soil | MATDIVAYGIYPDRASFESTLEALRAAGFRNSDISAILPDRDRTTRD |
Ga0062593_1004749241 | 3300004114 | Soil | VATDYVAYGIYPDRTSFDTALEGLRAAGFRNSDISAILPERDR |
Ga0062589_1015180121 | 3300004156 | Soil | MTTDIVAYGLYKDRESFERALDALRAANFRNSDVSAILPD |
Ga0063356_1026982862 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MATDLVAYAIYKDRESFETALDALRTAGFRNSDVSAIIPERD |
Ga0062594_1018695451 | 3300005093 | Soil | VATDYVAYGIYPDRASFDTALEGLRAAGFRNSDISAILPERDR |
Ga0062594_1020248671 | 3300005093 | Soil | MSKDLVAYGIYPDRASFEAALGALRAANFRNSDISAILPERDR |
Ga0070666_114040012 | 3300005335 | Switchgrass Rhizosphere | MSTDIVAYGLYKDRQSFERAVDALRAANFRNSDFSAILPDRDNTTKDLA |
Ga0070680_1017618981 | 3300005336 | Corn Rhizosphere | MSKDMVAYGIYPDRTSFERALDSLRAARFRNSDVSAILPERDQTTRDL |
Ga0070674_1004974153 | 3300005356 | Miscanthus Rhizosphere | MASDIVAYGIYPDRVSFERALEALRAAGFRNSDISAILPD |
Ga0070667_1008695492 | 3300005367 | Switchgrass Rhizosphere | MASDIVAYGIYPDRLAFERALEALRAAGFRNSDISAILPD |
Ga0070678_1008266552 | 3300005456 | Miscanthus Rhizosphere | MATDIVAYGLYKDRATFERAIDALRAANFRNSDVSAILPDRDHTT |
Ga0070706_1018939492 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTDIVAYGLYKDRASFELALEALRAAHFRNSDVSAILPDRDHTTRDLAHEINTKT |
Ga0068853_1012632641 | 3300005539 | Corn Rhizosphere | MSHDIVAYGIYADRDSFESALNALRVANFRNSDISVVLPERDRTTRDLA |
Ga0070664_1005734082 | 3300005564 | Corn Rhizosphere | VATDYVAYGIYPDRTSFDTALDGLRAAGFRNSDISAILPERDR |
Ga0068857_1005871403 | 3300005577 | Corn Rhizosphere | MATDIVAYGIYPDRASFEGTLEALRAAGFRNSDISAILPDRD |
Ga0068857_1023825882 | 3300005577 | Corn Rhizosphere | MSTDIVAYGLYKDRQSFERAVDALRAANFRNSDVSAILPDR |
Ga0068852_1017833001 | 3300005616 | Corn Rhizosphere | MATDIVAYGLYKDRASFERAVDALRAANFRNSDVSAILPDRDHTT |
Ga0068859_1020977722 | 3300005617 | Switchgrass Rhizosphere | MATDFVAYALFPDRDHFDAALEALRAAGFRNSDVSAIIPERDRTTKDLA |
Ga0068864_1004674193 | 3300005618 | Switchgrass Rhizosphere | MATDMVAYGIYPDRASFERTLEALRAAGFRNSDISAILPDRD |
Ga0068866_108088451 | 3300005718 | Miscanthus Rhizosphere | MNKDIVAYGIYPDRQTFDRALEALRAAGFRNSDVSAILPERD |
Ga0066903_1036983403 | 3300005764 | Tropical Forest Soil | MAADYLACGIYPDRDSFERAVDALRTAGFRNSDI* |
Ga0068851_103695381 | 3300005834 | Corn Rhizosphere | MATDLVAYGIYPDRTAFDRALEGLRAAGFRNSDISAILPERDQ |
Ga0068851_107927342 | 3300005834 | Corn Rhizosphere | MNKDIVAYGIYPDRQTFDRALEALRAAGFRNSDVS |
Ga0081455_102735611 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MATDKVAYGIYPDRGSFEHALEALRAAGFRSSDVS |
Ga0075422_103303542 | 3300006196 | Populus Rhizosphere | MATDIVAYGIYSDRLSFESALEALRAANFRNSDISAIFPERERTTKDLAH |
Ga0075428_1002961273 | 3300006844 | Populus Rhizosphere | MASDIVAYGIYPDRLSFERALEALRAAGFRNSDISAIL |
Ga0075431_1007197751 | 3300006847 | Populus Rhizosphere | VSTDYVAYGIYPDRASFESALEALRAAEFRNSDISAILP |
Ga0075420_1000453111 | 3300006853 | Populus Rhizosphere | MTTDLVAYAIYPDRSSFEAALEALRAAGFRNSDISAILPE |
Ga0079215_101106811 | 3300006894 | Agricultural Soil | MATDLVAYGIYPDRVAFERALESLRAAGFRNSDISAILP |
Ga0075436_1011489721 | 3300006914 | Populus Rhizosphere | MSTDMVAYGIYPDRVSFERALEALRAAGFRNSDVSAILPDRDRTARDFA |
Ga0111539_132796841 | 3300009094 | Populus Rhizosphere | MAKDLVTYGIYPDRASFERALEALRAAGFRNSDVSAILPD |
Ga0075418_122603301 | 3300009100 | Populus Rhizosphere | MASDLVAYALFPDRGRFEAALEALRDAGFRNSDISAIIPERDRTTKDLA |
Ga0075418_131559182 | 3300009100 | Populus Rhizosphere | MTTDIVAYGLYKDRESFERALEALRAANFRNSDISAILPDRDH |
Ga0105243_117860391 | 3300009148 | Miscanthus Rhizosphere | MTTDIVAYGLYKDRESFERAVEALRAANFRSSDVSA |
Ga0111538_122843051 | 3300009156 | Populus Rhizosphere | MATDFVAYGIYPHRDSFERALEALRTAGFRNSDISAILPERDRT |
Ga0105249_123301582 | 3300009553 | Switchgrass Rhizosphere | MATDLVSYGIYSDRASFEAGLDALRAAGFRNSDISAILPE |
Ga0105347_13342211 | 3300009609 | Soil | MTTDLVAYGLFPDRASFDNALGALRAAEFRNSDISAILPDRDH |
Ga0126308_105631502 | 3300010040 | Serpentine Soil | MANDMVAYAIYPDRARFDAALEALRDAGFRNSDISA |
Ga0126382_118469111 | 3300010047 | Tropical Forest Soil | MATDLVAYSIYPDRESFERAVEGLRAAGFRNSDISVI |
Ga0126382_122816151 | 3300010047 | Tropical Forest Soil | MSSDIVAYGIYPDRLSFERALEALRAAGFRNSDISAILPD |
Ga0134124_125574162 | 3300010397 | Terrestrial Soil | MATDMVAYGIYPDRESFERALEALRSAGFRNSDVSAILPDR |
Ga0134123_110563791 | 3300010403 | Terrestrial Soil | MNTDIVAYGLYKDRESFERALESLRAANFRNSDISAILPDRDHTTKD |
Ga0105246_123999171 | 3300011119 | Miscanthus Rhizosphere | MSHDIVAYGIYNDRESFEAALNALRTANFRNSDISVILPERDRT |
Ga0137426_11332561 | 3300011435 | Soil | MAKDMVAFGIYPDRMSFERALEALRVAQFRNSDISAILPERDR |
Ga0137382_112901261 | 3300012200 | Vadose Zone Soil | MSNDIVAYGLYPDRVSFESALEALRAAQFRNSDISVV |
Ga0157310_101667633 | 3300012916 | Soil | MATDISTFALYKDRKSFELALEALRAAQFRNSDVSAVLPERDQTTR |
Ga0164302_117945261 | 3300012961 | Soil | MSPSTEGILMATDMVAYGIYPDRASFERTLEALRAAEFRNSDISAI |
Ga0164306_104950782 | 3300012988 | Soil | MSNDYVAYGLYPDRESFERGIDSLRAASFRNSDISAIFPERDRTT |
Ga0164305_102651181 | 3300012989 | Soil | MSHDIVAYGIYAEREQFEAAINALRAANFRNSDISVILPER |
Ga0157378_130498851 | 3300013297 | Miscanthus Rhizosphere | MSPSTEGILMATDMVAYGICPDRASFERTLEDLRAAQFRDRDISAILHDGARTRR |
Ga0163162_113198423 | 3300013306 | Switchgrass Rhizosphere | MATDFVAYALFPDRDHFDAALEALRAAGFRNSDVSAIIPERDRTTK |
Ga0157375_109234722 | 3300013308 | Miscanthus Rhizosphere | MSTDIVAYGLYKDRASFERAVDALRAANFRNSDVSAILPDRDNTTKD |
Ga0157375_109738182 | 3300013308 | Miscanthus Rhizosphere | MSKDLVAYGIYPDRASFEAALGALRAANFRNSDISAIL |
Ga0157375_115401322 | 3300013308 | Miscanthus Rhizosphere | MATDLVAYGLYPNRESFDRALEALRTADFRNSDISAILPDRD |
Ga0157375_132064102 | 3300013308 | Miscanthus Rhizosphere | MATDMVAYGIYPDRESFERALESLRSAGFRNSDVSAILPDRDR |
Ga0075320_11030612 | 3300014255 | Natural And Restored Wetlands | MASDIVAYGIYPDRLAFERALEALRAAGFRNSDISAILPDR |
Ga0157380_123614071 | 3300014326 | Switchgrass Rhizosphere | MTDMVAYGIYPDRLAFERALEALRGAGFRNSDISAILPDRD |
Ga0157376_111756041 | 3300014969 | Miscanthus Rhizosphere | MSHDIVAYGIYAEREQFEAAINALRAANFRNSDISVILPERDRTTRDLAHQINT* |
Ga0173483_107623211 | 3300015077 | Soil | MASDMVAYGIYPDRLAFDRALEALRAAGFRNSDISAI |
Ga0132258_101823591 | 3300015371 | Arabidopsis Rhizosphere | MANDLVAYAVFPDRGRFEAALEALRDAGFRNSDVSAIIP |
Ga0132255_1035178141 | 3300015374 | Arabidopsis Rhizosphere | MATDMVAYGIYPDRIPFERALEALRSAGFRNSDISAILPD |
Ga0184634_101564502 | 3300018031 | Groundwater Sediment | MATDMVAYGIYPDSRSFEHALEALRAAGFRNSDVSAILPDRDRTARDLAHEI |
Ga0190270_112817381 | 3300018469 | Soil | MATDMVAYGIYPDRASFERTLEALQAAGFRNSDISAILPDRDRTTRD |
Ga0173479_107877362 | 3300019362 | Soil | MTTDLVAYGLYPTRESFERALEALRAADFRNSDISAILPDRDHTT |
Ga0247801_10885051 | 3300023064 | Soil | MATDLVAYGIYPDRVSFERALESLRAAGFRNSDISAILPERDRTTR |
Ga0207643_104965632 | 3300025908 | Miscanthus Rhizosphere | MATDIVAYGLYKDRASFERAIDALRAASFRNSDVSAILPDRDHTTKDLAHE |
Ga0207650_110062122 | 3300025925 | Switchgrass Rhizosphere | MSKDLVAYGIYPDRASFEAALGALRAANFRNSDISAILPERDRTT |
Ga0207659_114929342 | 3300025926 | Miscanthus Rhizosphere | MSTDIVAYGLYKDRQSFERAVDALRAANFRNSDVSAI |
Ga0207691_100875094 | 3300025940 | Miscanthus Rhizosphere | MATDMVAYGIYPDRASFERTLEALRAAGFRNSDISAILPDRDR |
Ga0207689_114732442 | 3300025942 | Miscanthus Rhizosphere | MSHDIVAYGIYNDRESFEAALNALRTANFRNSDIS |
Ga0207712_110072451 | 3300025961 | Switchgrass Rhizosphere | MATDLVAYGIYPDRTAFDRALEGLRAAGFRNSDISAILPERDQT |
Ga0207658_112031271 | 3300025986 | Switchgrass Rhizosphere | MSKDLVAYGIYPDRASFEAALGALRAANFRNSDISAILPERDRT |
Ga0207648_120572081 | 3300026089 | Miscanthus Rhizosphere | MTTDLVAYGLFPDRASFDNALGALRAAEFRNSDVSAILPDRDHTTKDLAHQINTTTP |
Ga0209811_100978192 | 3300027821 | Surface Soil | MSTDMVAYGIYPDRGSFEHALEALRAAGFRNSDVSAILPDRDRTARDLAH |
Ga0209486_103920841 | 3300027886 | Agricultural Soil | MATDLVAYGTYPDRGSFDNALGALRAAEFRNSDISAIFPDRDHTTKDLA |
Ga0209382_115787412 | 3300027909 | Populus Rhizosphere | MATDFVAYGIYPDRVSFERALEALRAAEFRNSDISVILPDRDHTTR |
Ga0268265_104328311 | 3300028380 | Switchgrass Rhizosphere | MTTDIVAYGLYKDRESFERAVDALRAANFRNSDVSAILPD |
Ga0268265_110518692 | 3300028380 | Switchgrass Rhizosphere | MSTDLVAFGIYPDRLAFERALESLRAAGFRNSDISAILPERD |
Ga0307503_104923241 | 3300028802 | Soil | MTTDIVAYGLYKDRESFERAVEALRAANFRNSDVS |
Ga0247825_101862511 | 3300028812 | Soil | MTTDLVAYGLYPTRESFERALEALRAADFRNSDISAILPDRDHT |
Ga0247825_103327672 | 3300028812 | Soil | MATDLVAYGLYPNRESFERALEALRAANFRNSDISAILPDRDHTTKD |
Ga0247825_114627772 | 3300028812 | Soil | MTTDLVAYGLFPDRASFDNALGALRAAEFRNSDVSAIL |
Ga0299913_106572441 | 3300031229 | Soil | MVKDIAAFGIYPDRASLETGLEALRAAGFRASDVSA |
Ga0310887_111261281 | 3300031547 | Soil | MASDIVAYGIYPDRVSFERALEALRAAGFRNSDISAILPDRDRTTRDL |
Ga0307405_116006352 | 3300031731 | Rhizosphere | MTTDLVAYAIFPDRASFESALEGLRAAGFRNSDISAILP |
Ga0307468_1025282711 | 3300031740 | Hardwood Forest Soil | MATDMVAYGIYPDRASFERTLEALRVAEFRNSDISAILPDRDRTTRD |
Ga0310907_106424142 | 3300031847 | Soil | MATDLVAYGIYADRVAFERALESLRAAGFRNSDISAILPER |
Ga0310900_114137112 | 3300031908 | Soil | VSTDFVAYGIYPDRASFESALEALRAAEFRNSDISAILP |
Ga0307412_106913773 | 3300031911 | Rhizosphere | MAKDLVTFGIYPDRESFETGLESLRSAGFRSSDVSAVLPER |
Ga0310903_106210731 | 3300032000 | Soil | VATDYVAYGIYPHRTSFDTALEGLRAAGFRNSDISAILPE |
Ga0310902_108204692 | 3300032012 | Soil | MTDMVAYGIYPDRLAFERALEALRSAGFRNSDISAILPDRD |
Ga0310899_106673642 | 3300032017 | Soil | VATDYVAYGIYPDRASFDTALESLRAAGFRNSDISAILPERDRTAR |
Ga0310890_102147523 | 3300032075 | Soil | MATDLVAYGIYPDRVSFERALESLRAAGFRNSDISAILPERDRTTRDLA |
Ga0310889_102317272 | 3300032179 | Soil | MATDIVAYGIYPDRASFEGTLEALRAAGFRNSDISAILPD |
Ga0310889_107644492 | 3300032179 | Soil | MSTDMVAYGIYPDRGSFEHALEALRAAGFRNSDVSAIFPDR |
Ga0310810_113287531 | 3300033412 | Soil | MSKDLVAYGIYPDRMAFERALDSLRAAGFRNSDVSAILP |
Ga0247830_113189981 | 3300033551 | Soil | MTTDLVAYGLYPTRESFERALEALRAADFRNSDISAILPDRDHTTKDLA |
Ga0364925_0054877_2_157 | 3300034147 | Sediment | MTTDIVAYGLYKDRASFERALDALRSANFRNSDVSAIFPDRDHTTKDLAHEI |
Ga0364927_0012558_1737_1865 | 3300034148 | Sediment | MTTDIVAYGLYKDRESFERALEALRAANFRNSDISAILPDRDR |
Ga0364923_0226959_2_142 | 3300034690 | Sediment | MTTDIVAYGLYKDRASFERALDALRSANFRNSDVSAIFPDRDHTTKD |
⦗Top⦘ |