NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101106

Metagenome / Metatranscriptome Family F101106

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101106
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 37 residues
Representative Sequence VLHWKPRLVAIAAVLALVLVALGGLGIEVDYNLYW
Number of Associated Samples 91
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 61.76 %
% of genes near scaffold ends (potentially truncated) 21.57 %
% of genes from short scaffolds (< 2000 bps) 83.33 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.588 % of family members)
Environment Ontology (ENVO) Unclassified
(23.529 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.039 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.03%    β-sheet: 0.00%    Coil/Unstructured: 53.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF00877NLPC_P60 47.06
PF00990GGDEF 8.82
PF01966HD 4.90
PF02786CPSase_L_D2 3.92
PF04191PEMT 0.98
PF08442ATP-grasp_2 0.98
PF10958DUF2759 0.98
PF01066CDP-OH_P_transf 0.98
PF16655PhoD_N 0.98
PF01039Carboxyl_trans 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0791Cell wall-associated hydrolase, NlpC_P60 familyCell wall/membrane/envelope biogenesis [M] 47.06
COG0458Carbamoylphosphate synthase large subunitAmino acid transport and metabolism [E] 1.96
COG0026Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase)Nucleotide transport and metabolism [F] 0.98
COG0045Succinyl-CoA synthetase, beta subunitEnergy production and conversion [C] 0.98
COG0151Phosphoribosylamine-glycine ligaseNucleotide transport and metabolism [F] 0.98
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 0.98
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 0.98
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 0.98
COG1042Acyl-CoA synthetase (NDP forming)Energy production and conversion [C] 0.98
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 0.98
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 0.98
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035918004|FACENC_F56XM5W01DQSY9All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
2228664021|ICCgaii200_c0914315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1901Open in IMG/M
3300000956|JGI10216J12902_105477019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1051Open in IMG/M
3300001686|C688J18823_10270971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1122Open in IMG/M
3300005441|Ga0070700_100946123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria705Open in IMG/M
3300005526|Ga0073909_10005937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3600Open in IMG/M
3300005526|Ga0073909_10037938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1690Open in IMG/M
3300005543|Ga0070672_100981562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria748Open in IMG/M
3300005614|Ga0068856_100071387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3437Open in IMG/M
3300005618|Ga0068864_100207897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1801Open in IMG/M
3300005713|Ga0066905_100790195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium822Open in IMG/M
3300005718|Ga0068866_10546832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria774Open in IMG/M
3300005719|Ga0068861_100291113All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300005764|Ga0066903_100139293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3444Open in IMG/M
3300005764|Ga0066903_100629158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1869Open in IMG/M
3300005764|Ga0066903_104330397All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300005841|Ga0068863_100906038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria882Open in IMG/M
3300005937|Ga0081455_10005409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria14018Open in IMG/M
3300005983|Ga0081540_1007772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia7590Open in IMG/M
3300005983|Ga0081540_1031831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2891Open in IMG/M
3300006579|Ga0074054_11739229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300006794|Ga0066658_10943759All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300006806|Ga0079220_11704406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium551Open in IMG/M
3300006852|Ga0075433_11088860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria695Open in IMG/M
3300006871|Ga0075434_100410635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1375Open in IMG/M
3300009093|Ga0105240_10697917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1108Open in IMG/M
3300009094|Ga0111539_10194141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2368Open in IMG/M
3300009101|Ga0105247_11218256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300009840|Ga0126313_10012146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5492Open in IMG/M
3300009840|Ga0126313_10463895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1011Open in IMG/M
3300009840|Ga0126313_11172826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300010036|Ga0126305_10546759All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300010039|Ga0126309_10063008All Organisms → cellular organisms → Bacteria1812Open in IMG/M
3300010041|Ga0126312_10130370All Organisms → cellular organisms → Bacteria1736Open in IMG/M
3300010047|Ga0126382_10347906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1134Open in IMG/M
3300010047|Ga0126382_10965793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria743Open in IMG/M
3300010047|Ga0126382_12187389All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300010359|Ga0126376_10823941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria909Open in IMG/M
3300010360|Ga0126372_10415878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1233Open in IMG/M
3300010371|Ga0134125_11265359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium805Open in IMG/M
3300011000|Ga0138513_100033655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300012208|Ga0137376_10556745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria993Open in IMG/M
3300012487|Ga0157321_1023842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300012505|Ga0157339_1030700All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300012882|Ga0157304_1040449All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300012899|Ga0157299_10009871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1593Open in IMG/M
3300012900|Ga0157292_10411378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300012905|Ga0157296_10008316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1694Open in IMG/M
3300012915|Ga0157302_10378746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300012948|Ga0126375_10135823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1526Open in IMG/M
3300012948|Ga0126375_12112346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300014497|Ga0182008_10580322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium627Open in IMG/M
3300015077|Ga0173483_10479000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium658Open in IMG/M
3300015262|Ga0182007_10128204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria852Open in IMG/M
3300015371|Ga0132258_13622172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1056Open in IMG/M
3300015372|Ga0132256_100425335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1432Open in IMG/M
3300015373|Ga0132257_100030699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5812Open in IMG/M
3300015373|Ga0132257_100884926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1118Open in IMG/M
3300017792|Ga0163161_11602084All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300018027|Ga0184605_10007614All Organisms → cellular organisms → Bacteria4026Open in IMG/M
3300018028|Ga0184608_10140945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1034Open in IMG/M
3300018072|Ga0184635_10210421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium774Open in IMG/M
3300018073|Ga0184624_10044931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1767Open in IMG/M
3300018433|Ga0066667_11052856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria703Open in IMG/M
3300018465|Ga0190269_11044991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium623Open in IMG/M
3300019279|Ga0184642_1603314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria730Open in IMG/M
3300019356|Ga0173481_10138986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria988Open in IMG/M
3300019868|Ga0193720_1060868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300019875|Ga0193701_1031595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1086Open in IMG/M
3300020004|Ga0193755_1091219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria970Open in IMG/M
3300020059|Ga0193745_1027652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1244Open in IMG/M
3300021445|Ga0182009_10464492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium663Open in IMG/M
3300023071|Ga0247752_1005785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1642Open in IMG/M
3300024055|Ga0247794_10010854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2108Open in IMG/M
3300024310|Ga0247681_1028893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria816Open in IMG/M
3300025552|Ga0210142_1032642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria992Open in IMG/M
3300025899|Ga0207642_10087065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1533Open in IMG/M
3300025901|Ga0207688_10506186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria757Open in IMG/M
3300025919|Ga0207657_10157621All Organisms → cellular organisms → Bacteria1845Open in IMG/M
3300025940|Ga0207691_10426407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1130Open in IMG/M
3300026041|Ga0207639_10059785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2937Open in IMG/M
3300026095|Ga0207676_10141176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2062Open in IMG/M
3300027787|Ga0209074_10476524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300027821|Ga0209811_10087841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1105Open in IMG/M
3300027874|Ga0209465_10623009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300027909|Ga0209382_10212935All Organisms → cellular organisms → Bacteria2209Open in IMG/M
3300028711|Ga0307293_10243554All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300028712|Ga0307285_10023520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1433Open in IMG/M
3300028744|Ga0307318_10022538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2032Open in IMG/M
3300028768|Ga0307280_10373875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300028791|Ga0307290_10031150All Organisms → cellular organisms → Bacteria1892Open in IMG/M
3300028799|Ga0307284_10044975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1533Open in IMG/M
3300028872|Ga0307314_10074223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria892Open in IMG/M
3300028878|Ga0307278_10186055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria927Open in IMG/M
3300030336|Ga0247826_11597244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300030511|Ga0268241_10013630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1541Open in IMG/M
3300031093|Ga0308197_10079004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria926Open in IMG/M
3300031938|Ga0308175_100081656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2917Open in IMG/M
3300031938|Ga0308175_100325362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1578Open in IMG/M
3300031995|Ga0307409_100119554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2228Open in IMG/M
3300031996|Ga0308176_11473168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria725Open in IMG/M
3300034172|Ga0334913_018536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1570Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.86%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil5.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.90%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.92%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.92%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.94%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.96%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.98%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.98%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.98%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.98%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.98%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2035918004Soil microbial communities from sample at FACE Site 2 North Carolina CO2-EnvironmentalOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012487Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510Host-AssociatedOpen in IMG/M
3300012505Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610Host-AssociatedOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019868Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300024310Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22EnvironmentalOpen in IMG/M
3300025552Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300034172Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACENCA_47143202035918004SoilGEVDVLHWKPRLVALTALLALVLIALAGLGTEIAYNLYW
ICCgaii200_091431532228664021SoilVLHWKPRLVAIAVVLALVLVALGGLGIEVSENYNLYW
JGI10216J12902_10547701913300000956SoilLHWSPRLVALAAALALVLLVLGGLGFEEPYNLYW*
C688J18823_1027097123300001686SoilLTLLHWKPRLVALAAVLALVLVALAGLGIELTYNLYW*
Ga0070700_10094612313300005441Corn, Switchgrass And Miscanthus RhizosphereQGRLKLLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW*
Ga0073909_1000593753300005526Surface SoilVLHWSPRVVALVAVLALVLIALGGLAEELTYNLYW*
Ga0073909_1003793833300005526Surface SoilMLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW*
Ga0070672_10098156213300005543Miscanthus RhizosphereLLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW*
Ga0068856_10007138723300005614Corn RhizosphereVLHWKPRLVALTAVLALVLIALAGLGTEIAYNLYW*
Ga0068864_10020789723300005618Switchgrass RhizosphereTLGRLKLLHWSPRLVALAAVLALVLLALGGLGIEAPYNLYW*
Ga0066905_10079019523300005713Tropical Forest SoilLHWKPRLVAIAVILALVLVALGGLGIEVVESYNLYW*
Ga0068866_1054683223300005718Miscanthus RhizosphereLKLLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW*
Ga0068861_10029111323300005719Switchgrass RhizosphereVLHWKPRLVAIAVVLALVLVALGGLGIEVGENYNLYW*
Ga0066903_10013929323300005764Tropical Forest SoilVLHWKPRLVALTAVLALVLIALAGLGVEFAYNLYW*
Ga0066903_10062915823300005764Tropical Forest SoilVLHWKPRLVAIAVVLALVLVALSGLGIEVVESYNLYW*
Ga0066903_10433039713300005764Tropical Forest SoilSWGRFQVLHWKPRLVAIAVVLALVLVALGGLGIEVGEYYNLYW*
Ga0068863_10090603823300005841Switchgrass RhizosphereLKLLHWSPRLVALAAVLALVLLALGGLGIEAPYNLYW*
Ga0081455_1000540963300005937Tabebuia Heterophylla RhizosphereVLHWKPRLVAIAVVLALVLVALSGLGTEVVESYNLYW*
Ga0081540_100777223300005983Tabebuia Heterophylla RhizosphereVLHWKPRLVAIAVVLALVLVAFGGLGIEVGESYNLYW*
Ga0081540_103183113300005983Tabebuia Heterophylla RhizosphereVLHWKPRLVAIAVVLALVLVALGGLGIEVGEYYNLYW*
Ga0074054_1173922923300006579SoilLTLLHWSPRVVALVAVLALVLIALGGLAEELTYNLYW*
Ga0066658_1094375923300006794SoilLLHWKPRLVALAAVLALVLVALAGLGIELTYNLYW*
Ga0079220_1170440623300006806Agricultural SoilVLHWKPRIVALVAVLALVAIVLAGLGVEISYILYW*
Ga0075433_1108886023300006852Populus RhizosphereRLKLLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW*
Ga0075434_10041063533300006871Populus RhizosphereVGRFTLLHWKPRLVAIAAVLALMLVALGGLAGELIEYNLYW*
Ga0105240_1069791723300009093Corn RhizosphereLIVLHWSPRVVALVAVLALVLIALGGLAEELTYNLYW*
Ga0111539_1019414143300009094Populus RhizosphereLHWKPRLVAIAVVLALVLVALGGLGIEVGENYNLYW*
Ga0105247_1121825623300009101Switchgrass RhizosphereLHWSPRLVALAAVLALVLLALGGLGIEAPYNLYW*
Ga0126313_1001214653300009840Serpentine SoilLLHWKPRLVAIAAVLALVLVALAGLGYELAYNLYW*
Ga0126313_1046389523300009840Serpentine SoilVLHWSPRLVALAAALALILIAFGGLGIDEPYNLYW*
Ga0126313_1117282623300009840Serpentine SoilVLHWKPRLVVIAAVLALVLVALGGLGIEVDYNLYW*
Ga0126305_1054675913300010036Serpentine SoilMLHWKPRLVAIAAVLALVLVALGGLGIEVDYNLYW*
Ga0126309_1006300823300010039Serpentine SoilMLHWNPRLVALTAAVVLILVALAGLGIETAYNLYW*
Ga0126312_1013037023300010041Serpentine SoilVLHWKPRLVAIAAVLALVLVALGGLGIEVDYNLYW*
Ga0126382_1034790623300010047Tropical Forest SoilLHWKPRLVAIAVVLVLVLIALGGLGIEVDYNLYW*
Ga0126382_1096579323300010047Tropical Forest SoilCNPSWGRFQVLHWKPRLVAIAIVLALVLVALSGLGIEVVESYNLYW*
Ga0126382_1218738923300010047Tropical Forest SoilLHWKPRLVAIAVVLALVLVALSGLGIEVVESYNLYW*
Ga0126376_1082394113300010359Tropical Forest SoilVLHWKPRLVALTAVLALVLIALGGLGTEIAYNLYW*
Ga0126372_1041587823300010360Tropical Forest SoilVLHWKPRLVALTALLALVLIALAGLGAEIAYNLYW*
Ga0134125_1126535923300010371Terrestrial SoilLGRLKLLHWRARLIALAAVLALILVALGGLGIEVPYNLYW*
Ga0138513_10003365513300011000SoilLLHWKPRLVAIAVVLALVLIALGGLGIEVDYNLYW*
Ga0137376_1055674533300012208Vadose Zone SoilLKLLHWSPRLVALVAVLALVLIALGGLAEELTYNLY
Ga0157321_102384223300012487Arabidopsis RhizosphereVGRFTLLHWKPRLVAIAAVLALMLVALGGLAVELIEYNLYW*
Ga0157339_103070023300012505Arabidopsis RhizosphereLLHWKPRLVAIAAVLALMLVALGGLAVELIEYNLYW*
Ga0157304_104044923300012882SoilLHWKPRLVAIAVVLALVLVALGGLGIEVDYNLYW*
Ga0157299_1000987123300012899SoilLHWKPRLVASAVVLALVLVALGGLGIEVGENYNLYW*
Ga0157292_1041137823300012900SoilLLHWKPRLVAIAVVLALVLVALGGLGIEVGENYNLYW*
Ga0157296_1000831623300012905SoilLHWKPRLVAIAVVQALVLVALGGLGIEVGENYNLYW*
Ga0157302_1037874623300012915SoilVLHWKPRLVALTALLALVLIALAGLGTEIAYNLYW*
Ga0126375_1013582323300012948Tropical Forest SoilLLHWKPRLVAIAVVLVLVLIALGGLGIEVDYNLYW*
Ga0126375_1211234613300012948Tropical Forest SoilLHWKPRLVAIAVVLALVLVALGGLGIEVGEYYNLYW*
Ga0182008_1058032213300014497RhizosphereLLHWKPRLVAIAAVLALVLLALGGLGIEVDYNLYW*
Ga0173483_1047900023300015077SoilLLHWKPRLVAIAVVLALVLVALGGLGIEVDYNLYW*
Ga0182007_1012820413300015262RhizosphereKLLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW*
Ga0132258_1362217223300015371Arabidopsis RhizosphereWGRFTLLHWKPRLVAIAVVLVLVLVALGGLGIEVDYNLYW*
Ga0132256_10042533513300015372Arabidopsis RhizosphereLLHWKPRLVAIAVVLVLVLVALGGLGIEADYNLYW*
Ga0132257_10003069963300015373Arabidopsis RhizosphereLLHWKPRLVAIAVVLVLVLVALGGLGIEVDYNLYW*
Ga0132257_10088492613300015373Arabidopsis RhizosphereVGRFTLLHWKPRLVAIAAVLALMLVALGGLAVELVEYNLYW*
Ga0163161_1160208423300017792Switchgrass RhizosphereLHWKPRLVAIAVVLALVLVALGGLGIEVGENYNLYW
Ga0184605_1000761443300018027Groundwater SedimentLTLLHWSPRLVALAAALALIVIAFGGLGIDEPYNLYW
Ga0184608_1014094523300018028Groundwater SedimentMLHWNPRLVALAAVIALILIALGGLGIETDYNLYW
Ga0184635_1021042123300018072Groundwater SedimentMLHWNPRLVALVAVIALILIALGGLGIETDYNLYW
Ga0184624_1004493123300018073Groundwater SedimentLLHWKPRLVAIAVVLALVLIALGGLGIGVDYNLYW
Ga0066667_1105285623300018433Grasslands SoilLTLLHWKPRLVALAAVLALVLVALGGLGVELPYNLYW
Ga0190269_1104499113300018465SoilLTLLHWSPRLVALAAALILIAFGGLGIDEPYNLYW
Ga0184642_160331423300019279Groundwater SedimentLTLLHWSPRLVALAAALALIAIAFGGLGIDEPYNLYW
Ga0173481_1013898623300019356SoilVLHWKPRLVAIAVVLALVLVALGGLGIEVGENYNLYW
Ga0193720_106086823300019868SoilMLHWSPRLVALAAALALIVLALGGLGIETFYNLYW
Ga0193701_103159523300019875SoilLKLLHWSPRLVALAAVLVLVLIALGGLGIELTYNLYW
Ga0193755_109121913300020004SoilGRLTLLHWSPRVVALVAVLALVLIALGGLAEELTYNLYW
Ga0193745_102765223300020059SoilMLHWKPRLVVLAAILALVLVALGGLGFEGSLSGYNLYW
Ga0182009_1046449223300021445SoilLLHWKPRLVAIAAVLALVLLALGGLGIEVDYNLYW
Ga0247752_100578523300023071SoilASCNPSWGRFQVLHWKPRLVAIAVVLALVLVALGGLGIEVGENYNLYW
Ga0247794_1001085423300024055SoilLLHWKPRLVAIAVVLALVLVALGGLGIEVDYNLYW
Ga0247681_102889323300024310SoilLKLLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW
Ga0210142_103264223300025552Natural And Restored WetlandsLTLLHWSPRLVALVAVLALVLIALGGLAESVTYNLYW
Ga0207642_1008706523300025899Miscanthus RhizosphereLIVLHWSPRVVALVAVLALVLIALGGLAEELTYNLYW
Ga0207688_1050618623300025901Corn, Switchgrass And Miscanthus RhizosphereRSKLLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW
Ga0207657_1015762123300025919Corn RhizosphereVLHWSPRVVALVAVLALVLIALGGLAEELTYNLYW
Ga0207691_1042640723300025940Miscanthus RhizosphereLLHWSPRLVALVAVLALVLIALGGLAEELTYSLYW
Ga0207639_1005978523300026041Corn RhizosphereVLHWRPRVVALVAVLALVLIALGGLAEELTYNLYW
Ga0207676_1014117623300026095Switchgrass RhizosphereLKLLYWSSRLVALAAVLALVLLALGGLGIEAPYNLYW
Ga0209074_1047652413300027787Agricultural SoilLLHWKPRLVAIAVVLVLVLVALGGLGIEVDYNLYW
Ga0209811_1008784123300027821Surface SoilMLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW
Ga0209465_1062300923300027874Tropical Forest SoilVLHWKPRLVAIAIVLALVLVALSGLGIEVVESYNLYW
Ga0209382_1021293513300027909Populus RhizosphereQVLHWKPRLVAIAVVLALVLVALGGLGIEVGENYNLYW
Ga0307293_1024355413300028711SoilLTLLHWSPRLVALAAALALIAVVLGGLGIEEPFNLYW
Ga0307285_1002352013300028712SoilSAVGRFTMLHWNPRLVALAAVIALILIALCGLGIETDYNLYW
Ga0307318_1002253823300028744SoilLTLLHWSPRLVALAAALALILIAFGGLGIDEPYNLYW
Ga0307280_1037387513300028768SoilLLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW
Ga0307290_1003115023300028791SoilLTLLHWSPRLVALAAVLVLVLIALGGLGIELTYNLYW
Ga0307284_1004497533300028799SoilLTLLHWSPRLVALAAALALILIALGGLGIDEPYNLYW
Ga0307314_1007422323300028872SoilTMLHWNPRLVALAAVIALILIALGGLGIETDYNLYW
Ga0307278_1018605513300028878SoilSLLHWSPRLVALAAALALILIAFGGLGIDEPYNLYW
Ga0247826_1159724413300030336SoilLTLLHWSPRVIALVAVLALVLIALGGLAEELTYNLYW
Ga0268241_1001363023300030511SoilLLHWRPRLVALAAVIALVLLALGGLGIEVDYNLYW
Ga0308197_1007900423300031093SoilVSTDRARLVALAAVIALILIALGGLGIETDYNLYW
Ga0308175_10008165623300031938SoilLKLLHWSPRVVALVAVLALVLIALGGLAEELTYNLYW
Ga0308175_10032536223300031938SoilVGRFTLLHWKPRLVAIAAVLALVLLALGGLGIEVDYNLYW
Ga0307409_10011955423300031995RhizosphereLLHWKPRLVATTAVLALVLVALGGLGIEVDYNLYW
Ga0308176_1147316823300031996SoilSAKAPRWRFHMLHWKPRLVAIAVVLALVLVALGGLGIEVDYNLYW
Ga0334913_018536_852_9593300034172Sub-Biocrust SoilMLHWNPRLIALAAAFALVLIALCGLGFEAVYNLYW

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.