NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100907

Metagenome / Metatranscriptome Family F100907

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100907
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 58 residues
Representative Sequence MTQRHDRLCALADSLPAAIRWRYCDYEQLLKKQLKIMLAPQVRLVWPPRDFNQTPHCE
Number of Associated Samples 76
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 73.53 %
% of genes near scaffold ends (potentially truncated) 34.31 %
% of genes from short scaffolds (< 2000 bps) 82.35 %
Associated GOLD sequencing projects 70
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.020 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.588 % of family members)
Environment Ontology (ENVO) Unclassified
(27.451 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(44.118 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.37%    β-sheet: 0.00%    Coil/Unstructured: 61.63%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF13505OMP_b-brl 24.51
PF07332Phage_holin_3_6 8.82
PF12277DUF3618 4.90
PF00691OmpA 2.94
PF13401AAA_22 1.96
PF02922CBM_48 0.98
PF07437YfaZ 0.98
PF00483NTP_transferase 0.98
PF01442Apolipoprotein 0.98
PF13493DUF4118 0.98
PF02518HATPase_c 0.98



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.02 %
UnclassifiedrootN/A0.98 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c0361755All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium502Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0832237All Organisms → cellular organisms → Bacteria → Proteobacteria1396Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0833403All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3256Open in IMG/M
3300000956|JGI10216J12902_107141535All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1448Open in IMG/M
3300000956|JGI10216J12902_120759476All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium577Open in IMG/M
3300004156|Ga0062589_100603052All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium953Open in IMG/M
3300004157|Ga0062590_101340362All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium708Open in IMG/M
3300004463|Ga0063356_101105640All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1142Open in IMG/M
3300005093|Ga0062594_102241662All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium592Open in IMG/M
3300005295|Ga0065707_10586486All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium698Open in IMG/M
3300005336|Ga0070680_100064078All Organisms → cellular organisms → Bacteria → Proteobacteria3012Open in IMG/M
3300005347|Ga0070668_100867202All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium805Open in IMG/M
3300005354|Ga0070675_100543762All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1050Open in IMG/M
3300005354|Ga0070675_102202387All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium508Open in IMG/M
3300005365|Ga0070688_101226935All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium603Open in IMG/M
3300005406|Ga0070703_10041557All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1434Open in IMG/M
3300005444|Ga0070694_100015047All Organisms → cellular organisms → Bacteria → Proteobacteria4849Open in IMG/M
3300005444|Ga0070694_101625259All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium549Open in IMG/M
3300005545|Ga0070695_100146508All Organisms → cellular organisms → Bacteria → Proteobacteria1643Open in IMG/M
3300005549|Ga0070704_101972102All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium542Open in IMG/M
3300005713|Ga0066905_101737297All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium574Open in IMG/M
3300005719|Ga0068861_100934529All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium824Open in IMG/M
3300006046|Ga0066652_100921728All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium833Open in IMG/M
3300006755|Ga0079222_10973324All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium725Open in IMG/M
3300006844|Ga0075428_100000272All Organisms → cellular organisms → Bacteria → Proteobacteria51381Open in IMG/M
3300006844|Ga0075428_101228865All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium789Open in IMG/M
3300006846|Ga0075430_100770439All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium793Open in IMG/M
3300006854|Ga0075425_100385117All Organisms → cellular organisms → Bacteria → Proteobacteria1615Open in IMG/M
3300007004|Ga0079218_10063774All Organisms → cellular organisms → Bacteria2359Open in IMG/M
3300007004|Ga0079218_11249238All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium776Open in IMG/M
3300007004|Ga0079218_11549790All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium722Open in IMG/M
3300007004|Ga0079218_12211612All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium639Open in IMG/M
3300007004|Ga0079218_12353331All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium625Open in IMG/M
3300007076|Ga0075435_101379851Not Available617Open in IMG/M
3300009078|Ga0105106_11249063All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium527Open in IMG/M
3300009087|Ga0105107_10066368All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium2548Open in IMG/M
3300009094|Ga0111539_11244904All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium864Open in IMG/M
3300009156|Ga0111538_13688038All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium531Open in IMG/M
3300010399|Ga0134127_10082003All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2773Open in IMG/M
3300011332|Ga0126317_11016712All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium792Open in IMG/M
3300011333|Ga0127502_10088308All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium591Open in IMG/M
3300011333|Ga0127502_10599391All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium2327Open in IMG/M
3300012896|Ga0157303_10062418All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium802Open in IMG/M
3300012901|Ga0157288_10073272All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium864Open in IMG/M
3300012909|Ga0157290_10136659All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium770Open in IMG/M
3300012943|Ga0164241_10506816All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium869Open in IMG/M
3300014326|Ga0157380_10004310All Organisms → cellular organisms → Bacteria → Proteobacteria9864Open in IMG/M
3300015371|Ga0132258_10077660All Organisms → cellular organisms → Bacteria → Proteobacteria7730Open in IMG/M
3300015371|Ga0132258_11540800All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1678Open in IMG/M
3300015372|Ga0132256_100739073All Organisms → cellular organisms → Bacteria → Proteobacteria1100Open in IMG/M
3300018422|Ga0190265_10069945All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium3163Open in IMG/M
3300018422|Ga0190265_10381157All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1504Open in IMG/M
3300018422|Ga0190265_11657948All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium750Open in IMG/M
3300018469|Ga0190270_10886354All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria908Open in IMG/M
3300018469|Ga0190270_11478055All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium728Open in IMG/M
3300018481|Ga0190271_11024647All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium950Open in IMG/M
3300018481|Ga0190271_12644271All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium602Open in IMG/M
3300019356|Ga0173481_10004894All Organisms → cellular organisms → Bacteria → Proteobacteria3544Open in IMG/M
3300019377|Ga0190264_12293035All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium506Open in IMG/M
3300025885|Ga0207653_10068177All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1212Open in IMG/M
3300025912|Ga0207707_11606672All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium512Open in IMG/M
3300025917|Ga0207660_10173582All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1670Open in IMG/M
3300025917|Ga0207660_10434383All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1060Open in IMG/M
3300025942|Ga0207689_10149470All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1925Open in IMG/M
3300026075|Ga0207708_10139450All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1901Open in IMG/M
3300026089|Ga0207648_10372045All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1291Open in IMG/M
3300026118|Ga0207675_101990728All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium599Open in IMG/M
3300027695|Ga0209966_1150172All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium542Open in IMG/M
3300027876|Ga0209974_10009140All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium3367Open in IMG/M
3300027876|Ga0209974_10252318All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium664Open in IMG/M
3300027886|Ga0209486_10008865All Organisms → cellular organisms → Bacteria → Proteobacteria4457Open in IMG/M
3300027886|Ga0209486_11094439All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium541Open in IMG/M
3300027907|Ga0207428_10011981All Organisms → cellular organisms → Bacteria → Proteobacteria7632Open in IMG/M
3300028380|Ga0268265_10424112All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1236Open in IMG/M
3300028587|Ga0247828_10313317All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium871Open in IMG/M
3300028812|Ga0247825_10061309All Organisms → cellular organisms → Bacteria → Proteobacteria2508Open in IMG/M
3300031226|Ga0307497_10159395All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium944Open in IMG/M
3300031538|Ga0310888_10171235All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1174Open in IMG/M
3300031538|Ga0310888_10288528All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium934Open in IMG/M
3300031548|Ga0307408_101126977All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium729Open in IMG/M
3300031548|Ga0307408_101315347All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium678Open in IMG/M
3300031548|Ga0307408_102099944All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium545Open in IMG/M
3300031562|Ga0310886_11097513All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium513Open in IMG/M
3300031731|Ga0307405_10937556All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium735Open in IMG/M
3300031824|Ga0307413_10248537All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1318Open in IMG/M
3300031852|Ga0307410_11260625All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium645Open in IMG/M
3300031854|Ga0310904_11202234All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium546Open in IMG/M
3300031911|Ga0307412_10285866All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1297Open in IMG/M
3300031995|Ga0307409_102417973All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium554Open in IMG/M
3300032005|Ga0307411_11093977All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium718Open in IMG/M
3300032012|Ga0310902_10626238All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium717Open in IMG/M
3300032013|Ga0310906_10958385All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium613Open in IMG/M
3300032126|Ga0307415_100227363All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1500Open in IMG/M
3300032144|Ga0315910_10006744All Organisms → cellular organisms → Bacteria → Proteobacteria9216Open in IMG/M
3300032144|Ga0315910_10065709All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium2640Open in IMG/M
3300032144|Ga0315910_10381223All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1078Open in IMG/M
3300032144|Ga0315910_10551814All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium891Open in IMG/M
3300032144|Ga0315910_10578919All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium869Open in IMG/M
3300032144|Ga0315910_10824787All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium722Open in IMG/M
3300032157|Ga0315912_10977529All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium672Open in IMG/M
3300032179|Ga0310889_10576044All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium578Open in IMG/M
3300033551|Ga0247830_11611308All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium520Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil9.80%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere9.80%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil7.84%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.88%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.92%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere3.92%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011333Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_036175512228664021SoilMTQRHDRLCALADSLPAAIRWRYCDYEQLLKKQLQIMLAPQLQLVWPPREFNQAPHCE
ICChiseqgaiiDRAFT_083223733300000033SoilMTQRHDRLCALANSLPAAIRWRYCDYEQLLKKQLKIMLAPXVXLVWPPRDFNRTPHCE*
ICChiseqgaiiDRAFT_083340343300000033SoilMTQRHDRLCALADSLPAAIRWRYCDYEQLLKKQLQIMLAPQVQLVWPPREFNQAPHCE*
JGI10216J12902_10714153523300000956SoilMTMTQRHDRLCALADSLPAAIRWRYCDYEQLLKKQLEIMLAPEVRLVWPRRGVDSSPRGD
JGI10216J12902_12075947613300000956SoilMTQPTDRLCVLADSLPGAIRWRFCDYEQLLKKQLQILLAPPVRLVQPDGQDRYTH*
Ga0062589_10060305223300004156SoilMTQRHDRLCPLANSLPAAIRWRYCDYEQLLKKQLKIMLAPQVQLVWPPRDFNQTPHCE*
Ga0062590_10134036223300004157SoilMTQRHDRLCALANSLPAAIRWRYCDYEQLLKKQLKIMLAPQVQLVWPPRDFNQTPHCE*
Ga0063356_10110564023300004463Arabidopsis Thaliana RhizosphereMTITQRHDRLCALADSLPAAIRWRYCDYEQLLKKQLEIMLAPEVKLVWPPRGVDPSPRCD
Ga0062594_10224166213300005093SoilARVRHTLGGLKMTQPQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLAPPVRLAWPPRGFEQAPPCE*
Ga0065707_1058648613300005295Switchgrass RhizosphereMTQRHDRLCALANSLPAAIRWRYCDYEQLLKKQLKIMLAPQVRLVWPPRDFNEAPYCE*
Ga0070680_10006407823300005336Corn RhizosphereMTQPQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLAPPVRLAWPPRGFEQAPPCE*
Ga0070668_10086720223300005347Switchgrass RhizosphereMTQRHDRLCALANSLPAAIRWRYCDYEQLLKKQLKIMLAPQVQLVWPPRHFNQTPHCE
Ga0070675_10054376213300005354Miscanthus RhizosphereVPSTSRPTRGTRMTQRHDRLCALANSLPAAIRWRYCDYEQLLKKQLKIMLAPQVQLVWPPRDFNQTPHCE*
Ga0070675_10220238713300005354Miscanthus RhizosphereMTQRHDRLCALANSLPAAIRWRYCDYEQLLKKQLKIMLAPQVQLVWPPR
Ga0070688_10122693523300005365Switchgrass RhizosphereGASEPNPLPTHTRGTQMMQPQGRLCALADSLPATIRWRYCDYEQLLKKQLQIMLATPVRLAWPPRGFDQAPPCE*
Ga0070703_1004155723300005406Corn, Switchgrass And Miscanthus RhizosphereMTQPQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLATPVRLAWPPRGFDQAPPCE*
Ga0070694_10001504713300005444Corn, Switchgrass And Miscanthus RhizosphereTATSAPTPIRGDEKMMQRHDNLCVLADSLPAAIRWRYSDYEQLLKKQLQIMLAPEMRLVWPPRVFEQTPPYGE*
Ga0070694_10162525923300005444Corn, Switchgrass And Miscanthus RhizosphereMTQPQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLATPVRLAWPQRGFEQAPPGE*
Ga0070695_10014650823300005545Corn, Switchgrass And Miscanthus RhizosphereMMQRHDNLCVLADSLPAAIRWRYSDYEQLLKKQLQIMLAPEMRLVWPPRVFEQTPPYGE*
Ga0070704_10197210223300005549Corn, Switchgrass And Miscanthus RhizosphereRLCALADSLPATIRWRYCDYEQLLKKQLQIMLAPPVRLAWPPRGFEQAPPCE*
Ga0066905_10173729713300005713Tropical Forest SoilMTQRHDRLCALADSLPAAIRWRYCDYEQLLKKQLRIMLAPQVRLVWPPRDFNQTPHCE*
Ga0068861_10093452913300005719Switchgrass RhizosphereTLGGLKMTQPQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLAPPVRLAWPPRGFEQAPPCE*
Ga0066652_10092172813300006046SoilMTQRNDRLCALANSLPAAIRWRYCDYEQLLKKQLQIMLAPQVWPAPPRRGVDEPPCE*
Ga0079222_1097332423300006755Agricultural SoilMTKRHEHLCALANSLPAAIRWRYCDYEQLLKKQLAIMLAPEARLVWPPRDFGQTPHCE*
Ga0075428_100000272343300006844Populus RhizosphereMTQRHDRLCALADSLPAAIRWRYCDYEQLLKKQLKIMLAPQVRLVWPPRDFNQTPHCE*
Ga0075428_10122886523300006844Populus RhizosphereMTQRHDSLCALADSLPAAIRWRYCDYEQLLKKQLRIMLAPQVRLVWPPRDFNQTPHCE*
Ga0075430_10077043933300006846Populus RhizosphereMTQRHDSLCALADSLPAAIRWRYCDYEQLLKKQLKIMLAPQVRLVWPPRDFN
Ga0075425_10038511713300006854Populus RhizosphereMTQRHDNLCVLANSLPAAIRWRYSDYEQLLKKQLQIMLAPQVRLAWPPRVFEQTPPYGE*
Ga0079218_1006377423300007004Agricultural SoilMTQRHDRLCALADSLPAAIRWRYSDYEQLLKKQLQILLAPQVRLVWPPRGFDEAPSGD*
Ga0079218_1124923813300007004Agricultural SoilMTQRHDRLCALADSLPAAIRWRYCDYEQLLKKQLQILLAPRLRLVSPPSGG
Ga0079218_1154979013300007004Agricultural SoilDRLCALADSLPAAIRWRYCDYEQLLKKQLRIMLAPQVRLVWPPRDFSQTPHCE*
Ga0079218_1221161233300007004Agricultural SoilMIQPNDRLCVLADSLPGAIRWRFCDYEQLLKKQLQILLAPSVRLAQSPPDAHDRSTH*
Ga0079218_1235333123300007004Agricultural SoilMTQRHDRLCALADSLPAAIRWRYCDYEQLLKKQLQIMLAPPLRLVSPSSGDERPVSSD*
Ga0075435_10137985113300007076Populus RhizosphereVLANSLPAAIRWRYSDYEQLLKKQLQIMLAPQVRLAWPPRVFEQTPPYGE*
Ga0105106_1124906323300009078Freshwater SedimentMTEPHDRLCVLADSLPAAIRWRFCDYEQILRKQLQILAPPLRLVWPPADAEDLPTE*
Ga0105107_1006636823300009087Freshwater SedimentMMTQRHDRLCALADSPSAAIRWRYCDYEQLLKKQLRILLAAPVRSVGPPPNGSGPPASFN
Ga0111539_1124490423300009094Populus RhizosphereMTQPQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLATPVRLAWPQRGFDQAPPGE*
Ga0111538_1368803823300009156Populus RhizosphereMMQRHDNLCVLADSLPAAIRWRYSDYEQLLKKQLQIMLAPEMRLVWPPRVFEQTPPY
Ga0134127_1008200353300010399Terrestrial SoilLCALADSLPATIRWRYCDYEQLLKKQLQIMLATPVRLAWPQRGFEQAPPGE*
Ga0126317_1101671223300011332SoilMTQRHDRLCALADSLPAAIRWRYSDYEQMLKKQLQIMAAPQVQLVWPRRGFEPAPPGE*
Ga0127502_1008830813300011333SoilAGARRFSRGNPMTMTQRHDRLCALADSLPAAIRWRYCDYEQLLKKQLAIMLAPEVELVWPPRGDSAPRSD*
Ga0127502_1059939113300011333SoilMTMTQRHDRLCALADSLPAAIRWRYCDYEQLLKKQLEILLAPEVKLVWPPRSVDSSPRGD
Ga0157303_1006241823300012896SoilMTQRHDRLCALANSLPAAIRWRYCDYEQLLKKQLKIMLAPQVQLVWPPRHFNQTPHCE*
Ga0157288_1007327223300012901SoilMTQRHDRLCALANSLSAAIRWRYCDYEQLLKKQLKIMLAPQVQLVWPPRDFNQTPHCE*
Ga0157290_1013665923300012909SoilMTQRHDRLCALANSLPAAIRWRYCDYEQLLKKQLKIMLAPEAQLVWPPRD
Ga0164241_1050681623300012943SoilMTQRHANLCALADSLPAAIRWRYCDYEQLLKKQIEILLAPAVRQVWPPRDAEQGPPS*
Ga0157380_1000431063300014326Switchgrass RhizosphereMTESHDRLCVLADSLPGAIRWRFCDYEQLLKKQLQLLASPSQVVRPLRGHDDRGPAAQRF
Ga0132258_1007766023300015371Arabidopsis RhizosphereMTQRHDNLCVLADSLPAAIRWRYSDYEQLLKKQLQIMLAPEMRLVWPPRVFEQTPPYGE*
Ga0132258_1154080023300015371Arabidopsis RhizosphereMTQRNDRLCALADSLPAAIRWRYCDYEQLLKKQLQIMLAPQVWLVPPPRGVDEPPC*
Ga0132256_10073907323300015372Arabidopsis RhizosphereMTQRHDNLCVLADSLPAAIRWRYSDYEQLLKKQLQIMLAPEMRLVWPPRVFEQTPPWGE*
Ga0190265_1006994523300018422SoilVTEPHDRLCVLADSLPAAIRWRFCDYEQLLKKQLQILAPPLRLVWPPRDAETLPTE
Ga0190265_1038115723300018422SoilMTQRHDRLCVLADSLPAAIRWRYCDYEQLLKKQLQILLAPPVKLIWPPAGGDEPPAT
Ga0190265_1165794813300018422SoilMSESHDRLCVLADSLPGAIRWRFCDYEQLLKKQLQILAPPLRLVWPKPDAEDLSTD
Ga0190270_1088635413300018469SoilESHDRLCVLADSLPGAIRWRFCDYEQLLKKQLQLLASPSQVVRPLRHDDRGPSARRF
Ga0190270_1147805523300018469SoilMTQRQDRLCALADSLPAAIRWRYCDYEQLLRKQLQIMLAPEVRLVWPPRNFEPRP
Ga0190271_1102464723300018481SoilMTESHDRLCVLADSLPGAIRWRFCDYKQLLKKQLQLLASPSLVVRPLRVHDDRGPSAQRF
Ga0190271_1264427123300018481SoilMTESHDRLCVLADSLPGAIRWRFCDYEQLLKKQLQLLASPSQVVRPLRDHDDRGPSARRF
Ga0173481_1000489453300019356SoilMTQRHDRLCALANSLPAAIRWRYCDYEQLLKKQLKIMLAPQVQLVWPPRDFNQTPHCE
Ga0190264_1229303533300019377SoilGLPMIQPNDRLCVLADSLPGAIRWRFCDYEQLLKKQLQILLAPPVRPVQRPCDAQDRSTH
Ga0207653_1006817733300025885Corn, Switchgrass And Miscanthus RhizosphereMTQPQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLATPVRLAWPPRGFDQAPPCE
Ga0207707_1160667223300025912Corn RhizospherePTRGTCMTQRHDRLCALANSLPAAIRWRYCDYEQLLKKQLKIMLAPQVQLVWPPRHFNQTPHCE
Ga0207660_1017358243300025917Corn RhizosphereRPPNRARIRRTLGGLKMTQPQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLAPPVRLAWPPRGFEQAPPCE
Ga0207660_1043438313300025917Corn RhizosphereRARIRHTLGGIRMTQPQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLAPPVRLAWPPRGFEQAPPCE
Ga0207689_1014947013300025942Miscanthus RhizosphereRHTLGGIRMTQPQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLATPVRLAWPPRGFDQAPPCE
Ga0207708_1013945013300026075Corn, Switchgrass And Miscanthus RhizospherePQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLATPVRLAWPPRGFDQAPPCE
Ga0207648_1037204523300026089Miscanthus RhizosphereMTQPQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLAPPVRLAWPPRGFDQAPPCE
Ga0207675_10199072823300026118Switchgrass RhizosphereQPQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLAPPVRLAWPPRGFEQAPPCE
Ga0209966_115017223300027695Arabidopsis Thaliana RhizosphereMTQPQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLATPVRLAWPQRGFEQAPPGE
Ga0209974_1000914053300027876Arabidopsis Thaliana RhizosphereMTQRHDRLCALANSLPAAIRWRYCDYEQLLKKQLKIMLAPEVQLVWPPRDFNQTPHCE
Ga0209974_1025231823300027876Arabidopsis Thaliana RhizosphereMTQPQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLATPVRLAWPQRGFEQAP
Ga0209486_1000886543300027886Agricultural SoilMTQRHDRLCALADSLPAAIRWRYSDYEQLLKKQLQILLAPQVRLVWPPRGFDEAPSGD
Ga0209486_1109443923300027886Agricultural SoilMTMTQRHDRLCALADSLPAAIRWRYSDYEHLLKKQLEIMLAPEVKLVWPPRGVDAPPRCD
Ga0207428_1001198143300027907Populus RhizosphereMTQRHDRLCALADSLPAAIRWRYCDYEQLLKKQLKIMLAPQVRLVWPPRDFNQTPHCE
Ga0268265_1042411223300028380Switchgrass RhizosphereMTQRHDRLCALANSLPAAIRWRYCDYEQLLKKQLKIMLAPQVRLVWPPRDFNE
Ga0247828_1031331723300028587SoilMTQRHDRLCALANSLPAAIRWRYCDYEQLLKKQLKIMLAPQVRLVWPPRDFNEAPYCE
Ga0247825_1006130923300028812SoilMTQRHDRLCALANSLPAAIRWRYCDYEQLLKKQLKVMLAPQVRLVWPPRDFNQTPHCE
Ga0307497_1015939523300031226SoilMMQRHDNLCVLADSLPAAIRWRYSDYEQLLKKQLQIMLAPEMRLVWPPRVFEQTPPYRE
Ga0310888_1017123523300031538SoilMTQRHDRLCALADSLPAAIRWRYCDYEQLLKKQLKIMLAPQVRLVWPPRDFSQTPHCE
Ga0310888_1028852813300031538SoilMTQPQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLATPVRLAWPPRGFEQVPPGE
Ga0307408_10112697723300031548RhizosphereMTEPDDRLCVLADSLPAAIRWRFCDYEQLLRKQLQLLAPPLRLVQPRRDAKELQTK
Ga0307408_10131534723300031548RhizosphereMTEPNDRLCVLADSLPAAIRWRFCDYEQLLRKQLQLLAPPLRLVRPPRDAKELQTK
Ga0307408_10209994413300031548RhizosphereTMTQPHDRLCVLADSLPGAIRWRFCDYEHLLKKQLKILLAPPLRAVRPSRGAGDLPSA
Ga0310886_1109751313300031562SoilGTQMTQPQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLATPVRLAWPQRGFEQAPPG
Ga0307405_1093755623300031731RhizosphereMTQPHDRLCVLADSLPGAIRWRFCDYEHLLKKQLKILLAPPLRAVRPSRGAGDLPSA
Ga0307413_1024853723300031824RhizosphereMTEPNDRLCVLADSLPAAIRWRFCDYEQLLRKQLQLLAPPLRLVQPRRDAKELQTK
Ga0307410_1126062513300031852RhizosphereTEPDDRLCVLADSLPAAIRWRFCDYEQLLRKQLQLLAPPLRLVRPPRDAKELQTK
Ga0310904_1120223413300031854SoilSEPNPLPTHTRGTQMTQPQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLATPVRLAWPPRGFDQAPPCE
Ga0307412_1028586623300031911RhizosphereMTQPHDRLCVLADSLPGAIRWRFCDYEHLLKKQLKILLAPPLRAVRPSRGAGDLPNA
Ga0307409_10241797323300031995RhizosphereLCVLADSLPAAIRWRFCDYEQLLRKQLQLLAPPLRLVRPPRDAKELQTK
Ga0307411_1109397713300032005RhizosphereMTQRHDRLCALANSLPAAIRWRYCDYEQLLKKQLKIMLAPQVQLVWPPRDFNQ
Ga0310902_1062623823300032012SoilMTQPQDRLCALADSLPATIRWRYCDYEQLLKKQLQIMLATPVRLAWPPRGFE
Ga0310906_1095838513300032013SoilMMQRHDNLCVLADSLPAAIRWRYSDYEQLLKKQLQIMLAPEMRLVWPPRVFEQTPPYGE
Ga0307415_10022736333300032126RhizosphereMTQPHDRLCVLADSLPGAIRWRFCDYEHLLKKQLKILLAPPLRAVRPSRGA
Ga0315910_1000674453300032144SoilMTQRHDRLCALADSLPAAIRWRYCDYEQLLKKQLKIMLAPQVRLVWPPRDFDQAPNCE
Ga0315910_1006570943300032144SoilMTQRHDRLCALADSLPAVIRWRYCDYEQLLKKQLQILLAPPLRIVSPPSGGEPPISSD
Ga0315910_1038122323300032144SoilMTQRHGNLCALADSLPAAIRWRYCDYEQLLKKQIEILLAPPARQVWPRRDGERGSSASG
Ga0315910_1055181413300032144SoilMTQRHDHLCALADSLPGAIRWRYCDYEQLLKKQLQLMLAPEVQLVWPQRGGIPPRYDRN
Ga0315910_1057891913300032144SoilMTQPHDRLCALADSLPAAIRWRYSDYEQLFRKQLAIMLRPDVHLVRPPRAAEQAPPRH
Ga0315910_1082478713300032144SoilGGLRMTQRHDRLCALADSLPAAIRWRYCDYEQLLKKQLKIMLAPQVRLVWPPRDFNQTPHCE
Ga0315912_1097752913300032157SoilMTQRHDRLCALADSLPAAIRWRYCDYEQLLKKQLQIMLAPQVQLVWPPREFNQAPHCE
Ga0310889_1057604413300032179SoilMTQRHDRLCPLANSLPAAIRWRYCDYEQLLKKQLKIMLAPQVQLVWPPRDFNQTPHCE
Ga0247830_1161130823300033551SoilMTESHDRLCVLADSLPGAIRWRFCDYEQLLKKQLQLLASSSQVVRPLREHRDRGPSA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.