Basic Information | |
---|---|
Family ID | F100865 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 43 residues |
Representative Sequence | HGVKIGDTKIGVQTQSSEKLPPAVGIVLLAGGVLALVLGSRKT |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.98 % |
% of genes near scaffold ends (potentially truncated) | 99.02 % |
% of genes from short scaffolds (< 2000 bps) | 91.18 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (67.647 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (10.784 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.353 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.176 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.58% β-sheet: 0.00% Coil/Unstructured: 70.42% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF00282 | Pyridoxal_deC | 8.82 |
PF00581 | Rhodanese | 3.92 |
PF03641 | Lysine_decarbox | 3.92 |
PF14716 | HHH_8 | 2.94 |
PF02274 | ADI | 2.94 |
PF01042 | Ribonuc_L-PSP | 1.96 |
PF07238 | PilZ | 1.96 |
PF05163 | DinB | 1.96 |
PF01594 | AI-2E_transport | 1.96 |
PF00912 | Transgly | 0.98 |
PF01145 | Band_7 | 0.98 |
PF06202 | GDE_C | 0.98 |
PF05598 | DUF772 | 0.98 |
PF00903 | Glyoxalase | 0.98 |
PF00486 | Trans_reg_C | 0.98 |
PF04134 | DCC1-like | 0.98 |
PF01165 | Ribosomal_S21 | 0.98 |
PF02371 | Transposase_20 | 0.98 |
PF02586 | SRAP | 0.98 |
PF02954 | HTH_8 | 0.98 |
PF01740 | STAS | 0.98 |
PF12779 | WXXGXW | 0.98 |
PF07676 | PD40 | 0.98 |
PF00202 | Aminotran_3 | 0.98 |
PF00112 | Peptidase_C1 | 0.98 |
PF13490 | zf-HC2 | 0.98 |
PF01230 | HIT | 0.98 |
PF00072 | Response_reg | 0.98 |
PF00106 | adh_short | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 8.82 |
COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 3.92 |
COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 2.94 |
COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 2.94 |
COG4874 | Uncharacterized conserved protein | Function unknown [S] | 2.94 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.96 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.96 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.96 |
COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.98 |
COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.98 |
COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 0.98 |
COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 0.98 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.98 |
COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 67.65 % |
Unclassified | root | N/A | 32.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001170|JGI12704J13340_1009392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
3300001593|JGI12635J15846_10622147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 626 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100614167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100954407 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10421816 | Not Available | 541 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10482831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300004631|Ga0058899_12172409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 891 | Open in IMG/M |
3300005454|Ga0066687_10102158 | Not Available | 1449 | Open in IMG/M |
3300005542|Ga0070732_10549281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 701 | Open in IMG/M |
3300005586|Ga0066691_10768323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300005602|Ga0070762_10218889 | Not Available | 1172 | Open in IMG/M |
3300005713|Ga0066905_100145704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1697 | Open in IMG/M |
3300005764|Ga0066903_101921884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1134 | Open in IMG/M |
3300005921|Ga0070766_10318788 | Not Available | 1002 | Open in IMG/M |
3300005921|Ga0070766_10637039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
3300006057|Ga0075026_100983934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300006059|Ga0075017_100813319 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300006791|Ga0066653_10200018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
3300007788|Ga0099795_10627522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300009630|Ga0116114_1035518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1446 | Open in IMG/M |
3300009631|Ga0116115_1183386 | Not Available | 529 | Open in IMG/M |
3300009634|Ga0116124_1121311 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300009639|Ga0116122_1076849 | Not Available | 1101 | Open in IMG/M |
3300009764|Ga0116134_1280087 | Not Available | 574 | Open in IMG/M |
3300009824|Ga0116219_10630578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300010343|Ga0074044_10559605 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300010379|Ga0136449_100281955 | All Organisms → cellular organisms → Bacteria | 3049 | Open in IMG/M |
3300010379|Ga0136449_102616811 | Not Available | 719 | Open in IMG/M |
3300012203|Ga0137399_11424361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
3300012971|Ga0126369_10499288 | Not Available | 1274 | Open in IMG/M |
3300013307|Ga0157372_10328577 | Not Available | 1780 | Open in IMG/M |
3300014152|Ga0181533_1059223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1913 | Open in IMG/M |
3300014156|Ga0181518_10172815 | Not Available | 1141 | Open in IMG/M |
3300014158|Ga0181521_10050480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2873 | Open in IMG/M |
3300014162|Ga0181538_10124601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1498 | Open in IMG/M |
3300014165|Ga0181523_10360642 | Not Available | 813 | Open in IMG/M |
3300014165|Ga0181523_10639040 | Not Available | 583 | Open in IMG/M |
3300014199|Ga0181535_10787649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter | 539 | Open in IMG/M |
3300014638|Ga0181536_10358413 | Not Available | 662 | Open in IMG/M |
3300014654|Ga0181525_10117983 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
3300015371|Ga0132258_11559655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1667 | Open in IMG/M |
3300016404|Ga0182037_11520655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300016730|Ga0181515_1076253 | All Organisms → cellular organisms → Bacteria | 7772 | Open in IMG/M |
3300017934|Ga0187803_10483241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300017946|Ga0187879_10615729 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300017955|Ga0187817_10991899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
3300018006|Ga0187804_10448491 | Not Available | 576 | Open in IMG/M |
3300018009|Ga0187884_10039988 | Not Available | 2258 | Open in IMG/M |
3300018012|Ga0187810_10460388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300018019|Ga0187874_10074434 | Not Available | 1518 | Open in IMG/M |
3300018020|Ga0187861_10244582 | Not Available | 785 | Open in IMG/M |
3300018038|Ga0187855_10530522 | Not Available | 686 | Open in IMG/M |
3300018042|Ga0187871_10136176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1394 | Open in IMG/M |
3300018043|Ga0187887_10627532 | Not Available | 634 | Open in IMG/M |
3300018057|Ga0187858_10290671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
3300018057|Ga0187858_10517994 | Not Available | 727 | Open in IMG/M |
3300018086|Ga0187769_10940650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
3300019082|Ga0187852_1026975 | All Organisms → cellular organisms → Bacteria | 2811 | Open in IMG/M |
3300020199|Ga0179592_10484400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300021407|Ga0210383_11476760 | Not Available | 563 | Open in IMG/M |
3300021432|Ga0210384_11361455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
3300021478|Ga0210402_10507214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1120 | Open in IMG/M |
3300021478|Ga0210402_10904412 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300021559|Ga0210409_10243393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1630 | Open in IMG/M |
3300021559|Ga0210409_10258234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1576 | Open in IMG/M |
3300021559|Ga0210409_10948041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
3300021560|Ga0126371_12890852 | Not Available | 582 | Open in IMG/M |
3300025444|Ga0208189_1014217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1824 | Open in IMG/M |
3300025903|Ga0207680_10111136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1777 | Open in IMG/M |
3300025906|Ga0207699_10288736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1142 | Open in IMG/M |
3300025913|Ga0207695_11113005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
3300025916|Ga0207663_10092274 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
3300025917|Ga0207660_10277656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1329 | Open in IMG/M |
3300026294|Ga0209839_10141832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
3300026928|Ga0207779_1040632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
3300027535|Ga0209734_1122392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300027590|Ga0209116_1130565 | Not Available | 549 | Open in IMG/M |
3300027604|Ga0208324_1038575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1419 | Open in IMG/M |
3300027654|Ga0209799_1050951 | Not Available | 926 | Open in IMG/M |
3300027874|Ga0209465_10511884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
3300027874|Ga0209465_10686245 | Not Available | 503 | Open in IMG/M |
3300027884|Ga0209275_10228907 | Not Available | 1014 | Open in IMG/M |
3300028380|Ga0268265_10197130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1743 | Open in IMG/M |
3300029957|Ga0265324_10158366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
3300030058|Ga0302179_10023766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2925 | Open in IMG/M |
3300030760|Ga0265762_1156809 | Not Available | 546 | Open in IMG/M |
3300031525|Ga0302326_12802354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300031708|Ga0310686_113880916 | Not Available | 509 | Open in IMG/M |
3300031718|Ga0307474_10114186 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
3300031720|Ga0307469_10944635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
3300031720|Ga0307469_12366896 | Not Available | 518 | Open in IMG/M |
3300031902|Ga0302322_103436950 | Not Available | 542 | Open in IMG/M |
3300031918|Ga0311367_11142677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
3300031941|Ga0310912_10503720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 944 | Open in IMG/M |
3300031962|Ga0307479_11159480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
3300032035|Ga0310911_10599898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
3300032180|Ga0307471_100391024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1515 | Open in IMG/M |
3300032180|Ga0307471_103479236 | Not Available | 557 | Open in IMG/M |
3300033158|Ga0335077_11409673 | Not Available | 671 | Open in IMG/M |
3300033887|Ga0334790_006612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6867 | Open in IMG/M |
3300034090|Ga0326723_0396099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300034125|Ga0370484_0030220 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 10.78% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 8.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.82% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.82% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.88% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.88% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.92% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.92% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.96% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.96% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.98% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.98% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.98% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.98% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.98% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001170 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025444 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026928 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes) | Environmental | Open in IMG/M |
3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12704J13340_10093923 | 3300001170 | Forest Soil | AKIGVQTQTSEKLPPAAGIILLVGGVVALALGARK* |
JGI12635J15846_106221472 | 3300001593 | Forest Soil | VPIPHSEKHGVKFGDAKISVETENSEKLPPAVGIVLLAGGIVALVLGLRKTSG* |
JGIcombinedJ26739_1006141673 | 3300002245 | Forest Soil | EDHSVKIGGAKLGVETEHTEKLPPAVGGILLVGGVLALVVGSRKA* |
JGIcombinedJ26739_1009544072 | 3300002245 | Forest Soil | GDAKIGVQTQHSEKLPPAVGIILLAGGVLALVVGVRK* |
JGIcombinedJ51221_104218161 | 3300003505 | Forest Soil | HGVKMGDTKIGEQTENSEKLPPAVDAVLLAGDVLVLVLGSRKT* |
JGIcombinedJ51221_104828312 | 3300003505 | Forest Soil | KIGDAKIGVQTEHSEKLPAGVGIVLLAGGVLALVLGSRKS* |
Ga0058899_121724091 | 3300004631 | Forest Soil | PVPHREHHGVKIGDAKIGIETENSDKLPPAAGVVLLAGGVLALVIGLRKT* |
Ga0066687_101021582 | 3300005454 | Soil | LRVGDAKVTVQTENREKLPPAVGIILIGGGVLSLVLGLRKN* |
Ga0070732_105492811 | 3300005542 | Surface Soil | PVPHREDHSVKIGDAKIGVQTENNEKLPPAVGIVLVAAGAMVLVFGARKS* |
Ga0066691_107683232 | 3300005586 | Soil | IGDAKIGVQTESSEKLPPVVGIVLLTGGVLALVLGARER* |
Ga0070762_102188892 | 3300005602 | Soil | KIGDTKIGVQTQSSEKLPPAVGIVLLAGGVLALILGSRKT* |
Ga0066905_1001457043 | 3300005713 | Tropical Forest Soil | HGVKIDNTKIGIQTETREKVPPAVGIVLLAGGAVALVLGSRKT* |
Ga0066903_1019218841 | 3300005764 | Tropical Forest Soil | KIGDTKIGVQTESSEKLPPAVGIVLLSGGVLALVLGARKT* |
Ga0070766_103187882 | 3300005921 | Soil | HGVKIGDTKIGVQTQSSEKLPPAVGIVLLAGGVLALILGSRKT* |
Ga0070766_106370391 | 3300005921 | Soil | HRESHGVKIGDAKIGVQTEHDEKLPPAVGVILLVGGVSALAAGARQA* |
Ga0075026_1009839342 | 3300006057 | Watersheds | HGVKIGDTKIGVQTEHNEKLPPAVGGILLAGGVLALVVGVRKT* |
Ga0075017_1008133191 | 3300006059 | Watersheds | RENHGIQIGDAKIGVQTQSSEKLPPAVGIVLLAGGVLALVVGLRKT* |
Ga0066653_102000181 | 3300006791 | Soil | KVGDAKFTVQTENREKLPPAVGIILIGGGVLSLVFGLRKN* |
Ga0099795_106275222 | 3300007788 | Vadose Zone Soil | QIGDAKIGVQTENSEKLPPAVGIVLLAGGILTLIIGARSA* |
Ga0116114_10355181 | 3300009630 | Peatland | ENHGVKIGDTKIGVQTQSSEKLPPAVGIVLVAGGVLALVLGSRKT* |
Ga0116115_11833861 | 3300009631 | Peatland | PHSENHGVKIGDTKIGVQTQSSEKLPPAVGIILLAGGVLALVLGSRKS* |
Ga0116124_11213112 | 3300009634 | Peatland | VKIGDTKIGVQTQSSEKLPPAVGIVLLAGGALALVLGSRKS* |
Ga0116122_10768491 | 3300009639 | Peatland | IGVQTQSSEKLPPAVGIVLLAGGALALVLGSRKS* |
Ga0116134_12800871 | 3300009764 | Peatland | HSVKIGDTKIGVQTQSSEKLPPAVGIVLLAGGALALVLGSRKS* |
Ga0116219_106305782 | 3300009824 | Peatlands Soil | NIGDAKIGVQTEHSEKLPPAVGIVLVAGGVLALVLGSRKA* |
Ga0074044_105596052 | 3300010343 | Bog Forest Soil | ENHSVKIGDTKIGVQTQSREKLPPAVGIVLLAGGVLALVLGSRKS* |
Ga0136449_1002819555 | 3300010379 | Peatlands Soil | GDAKIGVQTEHSEKLPPAVGIVLVAGGVLALVLGSRKA* |
Ga0136449_1026168111 | 3300010379 | Peatlands Soil | RESHGVRIGDANFSVQTEHSEKLPTAVGIVLVAGGVLALVLGSRKA* |
Ga0137399_114243611 | 3300012203 | Vadose Zone Soil | PHHENHGVQIGDAKIGVQTETSEKLPPAVGIVLLAGGILTLVLGARAS* |
Ga0126369_104992881 | 3300012971 | Tropical Forest Soil | KVGDAKIGIQTETSEKLPPAVGISLLSGGILVLLVGTRRS* |
Ga0157372_103285773 | 3300013307 | Corn Rhizosphere | MPHRDDHSVSIGDAKFSLQTESREKLPPAVGIVLIGGGVLSLVLGLRKN* |
Ga0181533_10592231 | 3300014152 | Bog | HGVKIGDTKIGVQTQSSEKLPPAVGIVLLAGGVLALVLGSRKT* |
Ga0181518_101728152 | 3300014156 | Bog | IGDTKIGVQTQSREKLPPAVGIVLLAGGVLALVLGGRKT* |
Ga0181521_100504805 | 3300014158 | Bog | IGVQTQSSEKLPPAVGIVLVAGGVLALVLGIRKT* |
Ga0181538_101246011 | 3300014162 | Bog | IGVQTQSSEKLPPAVGIVLVAGGVLALVLGSRKT* |
Ga0181523_103606421 | 3300014165 | Bog | DTKIGVQTQSSEKLPPAVGIVLVAGGVLALVLGSRKT* |
Ga0181523_106390401 | 3300014165 | Bog | SETHSVKIGDTKIGVQTQSREKLPPAVGIVLLAGGVLALVLGSRKS* |
Ga0181535_107876492 | 3300014199 | Bog | VKIGDTKIGVQTQSREKLPPAVGIVLVAGGILALVLGIRKT* |
Ga0181536_103584131 | 3300014638 | Bog | ENHTVRIGDTKIGVQTQSREKLPPAVGIVLLAGGVLALVLGGRKT* |
Ga0181525_101179831 | 3300014654 | Bog | IGVQTESSQKLPPAVGIVLLVGGVVALGLGARKT* |
Ga0132258_115596551 | 3300015371 | Arabidopsis Rhizosphere | PRRESHGVKINDTKIGIQTETREKLPPAVGIVLLAGGALAVVLGARKT* |
Ga0182037_115206551 | 3300016404 | Soil | VKIGDAKIGVQTEHSEKLPSGVGIVLLAGGVLALVLGSRKS |
Ga0181515_10762536 | 3300016730 | Peatland | VPHSENHSVKFGDTKIGVQTQSSEKLPPAVGIVLVAGGVLALVLGSRKT |
Ga0187803_104832411 | 3300017934 | Freshwater Sediment | GVKIGDAKISVQTESDDKLPPAAGIVLLAGGVVALILGLRKT |
Ga0187879_106157292 | 3300017946 | Peatland | VRMGDTRIGVRTEHSETLPPAAGIVLLAGGVVALILGLRKP |
Ga0187817_109918991 | 3300017955 | Freshwater Sediment | SVKIGDAKFDLQTETSEKLPPAVGIVLLAAGVVVVVAGSRKS |
Ga0187804_104484911 | 3300018006 | Freshwater Sediment | VPHSENHSVKIGDTKIGVQTQHSEKLPPAVGIVLEAGGVLALVLGSRKT |
Ga0187884_100399881 | 3300018009 | Peatland | ENHGVKIGDTKIGVQTQSSEKLPPAVGIILLAGGVLALVLGSRKS |
Ga0187810_104603881 | 3300018012 | Freshwater Sediment | KFSVQTESSQLLPSAVGVILVGGGVVALVLGLRKS |
Ga0187874_100744341 | 3300018019 | Peatland | KIGVQTQSSEKLPPAVGIVLLAGGALALVLGSRKS |
Ga0187861_102445821 | 3300018020 | Peatland | KIGVQTQSSEKLPPAVGIVLLAGGVLALVLGSRKS |
Ga0187855_105305221 | 3300018038 | Peatland | GDTKIGVQTQSSEKLPPAVGIVLLAGGVFALVLGSRKT |
Ga0187871_101361761 | 3300018042 | Peatland | VKIGDTKIGVQTQSSERLPPAVGIVLLAGGVFSLIAGARKS |
Ga0187887_106275323 | 3300018043 | Peatland | TKIGVQTQHSEKLPPAVGVVLLAGGVVALAIGARKP |
Ga0187858_102906711 | 3300018057 | Peatland | TKIGVQTQSSEKLPPAVGIVLVAGGVLALVLGSRKT |
Ga0187858_105179941 | 3300018057 | Peatland | DTKIGVQTQSSEKLPPAVGIVLLAGGVLALVLGSRKT |
Ga0187769_109406502 | 3300018086 | Tropical Peatland | GDAKFSVQTETSEKLPPGVGIVLVAAGVVVVAVAARKA |
Ga0187852_10269751 | 3300019082 | Peatland | IGDTKIGVQTQSSEKLPPAVGIVLLAGGVLALVLGSRKT |
Ga0179592_104844002 | 3300020199 | Vadose Zone Soil | LPHHETHGVQIGDAKIGVQTETSEKLPPAVGIVLLAGGVLTLVLGARA |
Ga0210383_114767601 | 3300021407 | Soil | DRTYRKGVETEHTEKLPPAVGGILLVGGVLALVVGSRKA |
Ga0210384_113614551 | 3300021432 | Soil | LVVPVPQREDHSVKIGDAKIGVQTEHSEKLPAGVGIVLLAGGVLALVLGSRKS |
Ga0210402_105072142 | 3300021478 | Soil | PVPQSENHGLKIGDAKISVQTESSQKLPPAVGIVLVAGGVVALILGLRKT |
Ga0210402_109044121 | 3300021478 | Soil | AKISVQTETSEKLPPAAGIVLLAGGVLALIVGLRKA |
Ga0210409_102433931 | 3300021559 | Soil | SHSVKIGDTRIGVQTQHSEKLPAGVGIVLLAGGVLALVLGSRRS |
Ga0210409_102582343 | 3300021559 | Soil | ESHDLKIGDTKIGVQTESREKLPPAVGVVLVAGGVLALVLGSRKS |
Ga0210409_109480411 | 3300021559 | Soil | HRENHGLKIGDAKISVETESSDKLPPAAGIVLLAGGVVALVLGLRKT |
Ga0126371_128908522 | 3300021560 | Tropical Forest Soil | LVVPVPQRETHSVKIGDTRIGVQTQHSEKLPAGVGIVLVAGGVLALVLGSRTS |
Ga0208189_10142171 | 3300025444 | Peatland | ENHGVKIGDTKIGVQTQSSEKLPPAVGIVLVAGGVLALVLGSRKT |
Ga0207680_101111363 | 3300025903 | Switchgrass Rhizosphere | HGVKVGDAKIGIQTESKEKLPPAVGIVLVAGGVIALVAGSRKG |
Ga0207699_102887364 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LALTVPVPQREDHSVKIGDAKIGVQTQSSQKLPPVVGIILIAGGVLALVAGSRKS |
Ga0207695_111130052 | 3300025913 | Corn Rhizosphere | PMPHRDDHSVSIGDAKFTLQTESREKLPPAVGIVLIGGGVLSLVLGLRKN |
Ga0207663_100922741 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | DAKFSVQTETSEKLPPAVGIILIGGGVVALILGLRKA |
Ga0207660_102776561 | 3300025917 | Corn Rhizosphere | DAKIGIQTESKEKLPPAVGIVLVAGGVIALVAGSRKG |
Ga0209839_101418323 | 3300026294 | Soil | VPHSENHGVKIGDAKIGVQTEHSEKMPPAVGIVLLAGGVLALVFGSRKT |
Ga0207779_10406321 | 3300026928 | Tropical Forest Soil | GIKFGDAKISVRTESSEKLPPAAGIVLLAGGVVALILGLRKT |
Ga0209734_11223921 | 3300027535 | Forest Soil | GDAKISVETQSSDKLPPAVGIVLIAGGVVALVLGLRKA |
Ga0209116_11305651 | 3300027590 | Forest Soil | TKIGVQTQSSEKLPPAVGIVLLAGGVLALILGSRKT |
Ga0208324_10385752 | 3300027604 | Peatlands Soil | SENHSVKIGDTKIGVQTQSREKLPPAVGIVLLAGGVLALVLGSRKS |
Ga0209799_10509511 | 3300027654 | Tropical Forest Soil | PIPHRESRGVKMDDTKISIQRETREKLPPAVGIVLLAGSAVVLVLGSRKP |
Ga0209465_105118842 | 3300027874 | Tropical Forest Soil | HGIKVGDAKFSIQTEDSEKLPSSVGIILIGGGVVALILGLRKA |
Ga0209465_106862451 | 3300027874 | Tropical Forest Soil | TRIGVQTQHSEKLPAGVGIVLVAGGALALVLGSRTS |
Ga0209275_102289071 | 3300027884 | Soil | KIGDTKIGVQTQSSEKLPPAVGIVLLAGGVLALILGSRKT |
Ga0268265_101971301 | 3300028380 | Switchgrass Rhizosphere | HSENHGVKVGDAKIGIQTESKEKLPPAVGIVLVAGGVIALVAGSRKG |
Ga0265324_101583662 | 3300029957 | Rhizosphere | VKIGNAKLGVQTESSEKLPPAVGIVLLAGGVLALVMGSRKT |
Ga0302179_100237666 | 3300030058 | Palsa | VPVPQTENHGVKIGDTKIGVQTQHSEKLPPGVGAVLLAGGVIALVLGARKA |
Ga0265762_11568091 | 3300030760 | Soil | GDAKIGVQTQTSEKLPPAAGIILLVGGVVALALGARR |
Ga0302326_128023541 | 3300031525 | Palsa | GVKIGDTKIGVQTQHSEKLPPAVGVVLLVGGVVALALGVRKT |
Ga0310686_1138809162 | 3300031708 | Soil | VPHSENHGVKIGDTKIGVQTQSSEKLPSAVGIVLLVGGVVAVALGVRKP |
Ga0307474_101141863 | 3300031718 | Hardwood Forest Soil | ENHGVKMGDTKIGEQTENSEKLPPAVDAVLLAGDVLVLVLGSRKT |
Ga0307469_109446352 | 3300031720 | Hardwood Forest Soil | AFIVPIPHREQHGVQIGDAKIGVQTESSEKLPPVVGIVLLTGGVLALVLGARKS |
Ga0307469_123668961 | 3300031720 | Hardwood Forest Soil | VKIGDTKIGVQTENSEKHPPAVGAVLLAVGVLALVLGS |
Ga0302322_1034369502 | 3300031902 | Fen | HSEDHGVKIGDAKIGVTTQSSQKLPPAVGITLLVGGVLVLAVGSRNS |
Ga0311367_111426773 | 3300031918 | Fen | VVPIPHSEDHGVKVGDAKIGITTESSKKVPPAVGMTLVAAGVLVLFAGSRKT |
Ga0310912_105037201 | 3300031941 | Soil | KVGDAKFSIQTEDSEKLPSTVGIILIGGGVVALILGLRRG |
Ga0307479_111594801 | 3300031962 | Hardwood Forest Soil | KVGDAKFSIQTEDSEKLPPAVGIILIGGGVVALILGLRKA |
Ga0310911_105998982 | 3300032035 | Soil | IKVGDAKFSIQTEDSEKLPSTVGIILIGGGVVALILGLRRG |
Ga0307471_1003910241 | 3300032180 | Hardwood Forest Soil | ALVVPVPQRESHSVKIGDTRIGVQTQHSEKLPAGVGIVLLAGGVLALVLGSRRS |
Ga0307471_1034792361 | 3300032180 | Hardwood Forest Soil | VVPLPHRESHDLKIGDTKIGVQTESREKLPPAVGVVLVAGGVLALVLGSRKS |
Ga0335077_114096732 | 3300033158 | Soil | ERGVSIGDARFGVQIERREKLPPAVGVVLVAAGAVALLIGGRK |
Ga0334790_006612_44_193 | 3300033887 | Soil | MPHHEHHGMRIGDARVGVETEHHDMLPPAAGVVLLAGGVLALVLGLRKS |
Ga0326723_0396099_510_626 | 3300034090 | Peat Soil | GDAKIGVQTESSEKLPPAVGIVLLTSGVLALVVGSRKA |
Ga0370484_0030220_2_172 | 3300034125 | Untreated Peat Soil | LLSFLIPIPHRENHGLKIGDTKIGVQTESSEKLPPAVGIVLLAGGALALVLGSRKT |
⦗Top⦘ |