NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100820

Metagenome / Metatranscriptome Family F100820

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100820
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 40 residues
Representative Sequence MDYDAVLAQVLVLLQQEQRLSYRVLKLRLQLDDDTLE
Number of Associated Samples 85
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 94.12 %
% of genes from short scaffolds (< 2000 bps) 96.08 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.098 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(15.686 % of family members)
Environment Ontology (ENVO) Unclassified
(25.490 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(42.157 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.00%    β-sheet: 0.00%    Coil/Unstructured: 60.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF13424TPR_12 29.41
PF13432TPR_16 5.88
PF13181TPR_8 3.92
PF07719TPR_2 3.92
PF13374TPR_10 1.96
PF13191AAA_16 1.96
PF01593Amino_oxidase 0.98
PF13414TPR_11 0.98
PF07721TPR_4 0.98
PF01266DAO 0.98
PF04909Amidohydro_2 0.98
PF13176TPR_7 0.98
PF14559TPR_19 0.98
PF13683rve_3 0.98
PF05118Asp_Arg_Hydrox 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG3555Aspartyl/asparaginyl beta-hydroxylase, cupin superfamilyPosttranslational modification, protein turnover, chaperones [O] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.10 %
UnclassifiedrootN/A4.90 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_104884144All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium546Open in IMG/M
3300004463|Ga0063356_102069191All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300005294|Ga0065705_10367986All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300005295|Ga0065707_10664100All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300005332|Ga0066388_100252118All Organisms → cellular organisms → Bacteria → Proteobacteria2404Open in IMG/M
3300005713|Ga0066905_102330900All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300005719|Ga0068861_100562186All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300005764|Ga0066903_106861625All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300005764|Ga0066903_108040503All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300005764|Ga0066903_108631983All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300005764|Ga0066903_108850439All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300005842|Ga0068858_100964040All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300005981|Ga0081538_10194408All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300006049|Ga0075417_10265536All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300006049|Ga0075417_10702224All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300006794|Ga0066658_10891255All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300006844|Ga0075428_100673388All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300006845|Ga0075421_100103515All Organisms → cellular organisms → Bacteria3581Open in IMG/M
3300006845|Ga0075421_101506596All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300006846|Ga0075430_100164402All Organisms → cellular organisms → Bacteria1847Open in IMG/M
3300006846|Ga0075430_100186980Not Available1722Open in IMG/M
3300006847|Ga0075431_100523057All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300006854|Ga0075425_101439960All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300006880|Ga0075429_100655479All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300006880|Ga0075429_101352525All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300009012|Ga0066710_101508085All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300009038|Ga0099829_11123105All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300009090|Ga0099827_10574849All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium971Open in IMG/M
3300009100|Ga0075418_13132799All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300009146|Ga0105091_10101058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium1321Open in IMG/M
3300009157|Ga0105092_10744487All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300009162|Ga0075423_12654195All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300009162|Ga0075423_12882104All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium527Open in IMG/M
3300009168|Ga0105104_10174257All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300009792|Ga0126374_10793957All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300010043|Ga0126380_11599726All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300010046|Ga0126384_10840743Not Available825Open in IMG/M
3300010047|Ga0126382_12253259All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300010358|Ga0126370_10925406All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300010358|Ga0126370_11115805All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300010359|Ga0126376_10917044All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300010359|Ga0126376_12771960Not Available540Open in IMG/M
3300010361|Ga0126378_12567921All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300011270|Ga0137391_10367618All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300012206|Ga0137380_11239994All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium631Open in IMG/M
3300012209|Ga0137379_11005222All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300012350|Ga0137372_10813958All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300012360|Ga0137375_11365864Not Available530Open in IMG/M
3300012361|Ga0137360_10326308All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor1280Open in IMG/M
3300012685|Ga0137397_11236644All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium535Open in IMG/M
3300012917|Ga0137395_11156401All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium545Open in IMG/M
3300012929|Ga0137404_10001753All Organisms → cellular organisms → Bacteria → Proteobacteria14279Open in IMG/M
3300012971|Ga0126369_10577187All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300013308|Ga0157375_11333626All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300014154|Ga0134075_10432188All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium584Open in IMG/M
3300014968|Ga0157379_10735956All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300015374|Ga0132255_106296625All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300016371|Ga0182034_10420567All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300016422|Ga0182039_10874461All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300016422|Ga0182039_10951036All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300018063|Ga0184637_10107682All Organisms → cellular organisms → Bacteria1716Open in IMG/M
3300018078|Ga0184612_10405520All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300018422|Ga0190265_12807075All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium582Open in IMG/M
3300018469|Ga0190270_13111485All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300019789|Ga0137408_1186195All Organisms → cellular organisms → Bacteria3109Open in IMG/M
3300022195|Ga0222625_1269436All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300022563|Ga0212128_10629685All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300025936|Ga0207670_10109368All Organisms → cellular organisms → Bacteria1989Open in IMG/M
3300026035|Ga0207703_11120848All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300026075|Ga0207708_11795801All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300027846|Ga0209180_10671686All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300027873|Ga0209814_10189321All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300027907|Ga0207428_10478496All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300031092|Ga0308204_10211650All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300031421|Ga0308194_10300184All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300031564|Ga0318573_10361075All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300031668|Ga0318542_10341880All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300031681|Ga0318572_10884318All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300031719|Ga0306917_11230902All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300031724|Ga0318500_10405083All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300031724|Ga0318500_10640818All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300031747|Ga0318502_10702626All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300031893|Ga0318536_10696361All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300031912|Ga0306921_12260319All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium571Open in IMG/M
3300031912|Ga0306921_12269569All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300031942|Ga0310916_10703560All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300031954|Ga0306926_10524646All Organisms → cellular organisms → Bacteria1454Open in IMG/M
3300031954|Ga0306926_11054990All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300031954|Ga0306926_12484025All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300031981|Ga0318531_10507744All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300032002|Ga0307416_103121992All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300032013|Ga0310906_10386221All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300032055|Ga0318575_10698326All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300032066|Ga0318514_10540686All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300032076|Ga0306924_11961053All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300032089|Ga0318525_10651875All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium536Open in IMG/M
3300032205|Ga0307472_100121421Not Available1848Open in IMG/M
3300032261|Ga0306920_101253501All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla1069Open in IMG/M
3300032261|Ga0306920_101732357All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300032261|Ga0306920_101824978All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300033289|Ga0310914_10821600All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300033814|Ga0364930_0235132All Organisms → cellular organisms → Bacteria621Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere15.69%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.96%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.98%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.98%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.98%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.98%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.98%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022563OV2_combined assemblyEnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10488414413300000956SoilMDYDAVLAQVLVILQQEKRVAYRVLKRRLQLDDEML
Ga0063356_10206919123300004463Arabidopsis Thaliana RhizosphereMDYDALVTQALTLLQREQRLSYRMLKLRLQLDDDTLEALKEDL
Ga0065705_1036798623300005294Switchgrass RhizosphereMDYDAVLAQVLALLQQEQRLSYRVLKRRLQLDDDLLTSGVSL*
Ga0065707_1066410023300005295Switchgrass RhizosphereMDYDAVLAQVLALLQQEQRLSYRVLKRRLQLDDDLLTNGVSL*
Ga0066388_10025211843300005332Tropical Forest SoilMDYDTVLAQVVALLQQEQRVAYRVLKRRLQLDDEEAEKHL*
Ga0066905_10233090023300005713Tropical Forest SoilMDYDAILEQAIALLQREQRLSYRVLKRRLQLDDEMLE
Ga0068861_10056218613300005719Switchgrass RhizosphereMDYEAVRAQVLALLQQEQRLSYRVLKRQLQLDDDTL
Ga0066903_10686162513300005764Tropical Forest SoilMDYDAIVTQALTLLQREQRLSYRVLKLRLQLDDDTLEALKEDL
Ga0066903_10804050323300005764Tropical Forest SoilMDYDAVLAQVLELLQRELRLSYRVLKLRFQLDDETLEALKEDLVYAKQ
Ga0066903_10863198313300005764Tropical Forest SoilMDYEAVLAQVLVLLQQEQRVAYRILKRRFALDDNDLED
Ga0066903_10885043923300005764Tropical Forest SoilMDYDAVLTHILALLQQEQRIAYRVLKRRLQLDDELLEDL
Ga0068858_10096404023300005842Switchgrass RhizosphereMDYEAIVSQALALLQREQRLSYRVLKLRLHLDDDLL
Ga0081538_1019440813300005981Tabebuia Heterophylla RhizosphereMDYDAVLEQAIVLLQREQRLSYRVLKLRLQLDDDSLEALKEDLIY
Ga0075417_1026553613300006049Populus RhizosphereMDYDAIVTQALTLLQRERRLAYRVLKLRLQIDDDL
Ga0075417_1070222423300006049Populus RhizosphereMDYEAVLAQVLALLQQEQRLSYRVLKRRLHLDDDLLE
Ga0066658_1089125523300006794SoilMDYDVIVAQALALLQREQRLSYRVLKLRLQLDDDTLEALT
Ga0075428_10067338813300006844Populus RhizosphereMDYDAVLAQMLALLQQEQRLSYRVLKLRFQLDDDTLEALKEDLIYA
Ga0075421_10010351523300006845Populus RhizosphereMDYEAVLIQVLALLQQEQRLSYRVLKRRLHLDDDLLE
Ga0075421_10150659623300006845Populus RhizosphereMMDYDALLVQVLDLLQREQRVAYRILKRRLQLDDE
Ga0075430_10016440213300006846Populus RhizosphereMDYDAVLAQVLDLLQRDKRLSYRVLKRRLGVDDDELE
Ga0075430_10018698013300006846Populus RhizosphereMDYDAIVTQALTLLQREQRLSYRVLKLRLQLDDDT
Ga0075431_10052305713300006847Populus RhizosphereMDYDTVLAQVLALLQQEKRLSYRVLKLRFQLDDETLEALKED
Ga0075425_10143996013300006854Populus RhizosphereMDYDAVVTQALTLLQREQRLSYRVLKLRLQIDDDLLEALKDDLIYAKRLA
Ga0075429_10065547913300006880Populus RhizosphereMDYDAVLAQVLALLQQEKRISCRVLKLRLQLDDDLLEALKED
Ga0075429_10135252513300006880Populus RhizosphereMMDYEAVLAHVLALLQQEQRIAYRVLKRRLQLDDEIL
Ga0066710_10150808513300009012Grasslands SoilMDYEAVLAQVLALLQREQRLSYRVLKLRLQFDDDL
Ga0099829_1112310513300009038Vadose Zone SoilMDYDAIVTQALALLQREQRLAYRVLKLRLQLDDDLLEALKDDLI
Ga0099827_1057484923300009090Vadose Zone SoilMDYQAIRAQVLAFLQQEHRVAYRVLKRQFQLDDETLD
Ga0075418_1313279923300009100Populus RhizosphereMDYDAIVTQALTLLQREQRLSYRVLKLRLQLDDDTLEALKEDLVYAK
Ga0105091_1010105833300009146Freshwater SedimentMMDYEAILSQVVALLQRERRIASRVLKRQMQLDDDLLEDLKDDLIYA
Ga0105092_1074448723300009157Freshwater SedimentMDYDALDRVLALLRREKRLAYRVLRRRLQLDDETLEDLKDDLSY
Ga0075423_1265419523300009162Populus RhizosphereMDYEAVLAHVLALLQQEQRIAYRVLKRRLQLDDEILE
Ga0075423_1288210413300009162Populus RhizosphereMDYEAVLIQVLALLQQEQRLSYRVLKRRLHLDDDL
Ga0105104_1017425713300009168Freshwater SedimentMDYDAVLDQVVALLQQHKRLSYRVLKLRLQLDDDTLEA
Ga0126374_1079395713300009792Tropical Forest SoilMDYDTVLAQVLALLQQEKRLSYRVLKLRFQLDDETLEALK
Ga0126380_1159972623300010043Tropical Forest SoilMDYDAVLAQVLVLLQQEQRLSYRVLKLRLQLDDDTLE
Ga0126384_1084074313300010046Tropical Forest SoilMNYEEILAQVIALLQQEHRIAYRVLKRRLGLDDDLLEELKD
Ga0126382_1225325923300010047Tropical Forest SoilMDYDTVLAQALALLQREHRLSYRVLKLRLQLDDDLLEVLKEDL
Ga0126370_1092540613300010358Tropical Forest SoilMDYDAVLAQVLALLQQEKRLSYRVLKLRFHLDDETLEAL
Ga0126370_1111580523300010358Tropical Forest SoilMDYETVLAQALALLQQEKRLSYRVIKLRLQLDEET
Ga0126376_1091704423300010359Tropical Forest SoilMDYDATLAQVIVLLQQEQRIAYRVLKRRLQLDDETLEDLK
Ga0126376_1277196013300010359Tropical Forest SoilMAREAVLAQVLELLQREHRLSYRVLKLRFQLDDETLEALKED
Ga0126378_1256792123300010361Tropical Forest SoilMDYETVLAQVLALLQQEQRLSYRVLKLRFQLDDDTLETLKED
Ga0137391_1036761813300011270Vadose Zone SoilMDYDAVLAHVLDLLQREQRIAYRVLKRRLQLDDEI
Ga0137380_1123999413300012206Vadose Zone SoilMDYDAVLAQVLALLQREKRLSYRILKRRFALDDNDLE
Ga0137379_1100522223300012209Vadose Zone SoilMDYDAVLAQVLELLQQEQRLSYRVLKRRLHLDDDVL
Ga0137372_1081395813300012350Vadose Zone SoilMMDYDAVLAQVLALLRQENRLAYRVLKRRFQPDDDL
Ga0137375_1136586413300012360Vadose Zone SoilMDYEAVRAQVLALLQQEQRLSYRVLKRQLQLDDDT
Ga0137360_1032630823300012361Vadose Zone SoilMMDYDAIVAQALTLLQREQRPSYRVLKLRLHLDDDTLEALK
Ga0137397_1123664413300012685Vadose Zone SoilMDYDGVLEQVVALLQREKRLSYRVLKRRLQLDDEM
Ga0137395_1115640113300012917Vadose Zone SoilMDYDAVLAQVLALLQREQRLSYRVLKRRLHLDDDV
Ga0137404_1000175343300012929Vadose Zone SoilMDYDGVLEQVVALLQREKRLSYRVLKLRLQLDDDTLEALKEDLIYAKHLGDG*
Ga0126369_1057718713300012971Tropical Forest SoilMDYDAVLAQALALLQQEQRLSYRVLKLRLQLDDDTLEALKED
Ga0157375_1133362623300013308Miscanthus RhizosphereMDYEAIVSQALALLQREQRLSYRVLKLRLHLDDDLLEALKE
Ga0134075_1043218823300014154Grasslands SoilMDYEAIVTQAMTLLRREQRLSYRVLKLRLQLDDETLEALQANKPATAR
Ga0157379_1073595613300014968Switchgrass RhizosphereMDYDTVLAQVLALLQQEKRLSYRVLKLRFQLDDDTLEALKEDLVY
Ga0132255_10629662513300015374Arabidopsis RhizosphereMDYDAVLAHVLDLLQREQRLSYRVLKLRLQLDDDML
Ga0182034_1042056713300016371SoilMDYDVILAQVLMLLQREKRLSYRVLKLRFQLDDETLEALKEDLVY
Ga0182039_1087446123300016422SoilMDYDAVMAQVLALLQQEQRLSYRVLKLRFQLDDETLEALKED
Ga0182039_1095103613300016422SoilMDYDAILAQVLTLLQQEQRLSYRVLKRRLQLDDELLEDL
Ga0184637_1010768213300018063Groundwater SedimentMDYDAVLAQVLALLQQEKRVAYRVLKRQLQLDGEMIEDLKDD
Ga0184612_1040552013300018078Groundwater SedimentMDYEAVRVQVLALLQQEQRLSYRVLKRQFQLDDDTLED
Ga0190265_1280707513300018422SoilMDFDAVPKQAIALLQRQRRLSYRVLKLRLQLDDERLADLKEDLISFGPL
Ga0190270_1311148513300018469SoilMDYEVVLAQVLTLLQQEQRLSYRVLKLRLRLNDDTLEALKEDLIY
Ga0137408_118619523300019789Vadose Zone SoilMDYDGVLEQVVALLQREKRLSYRVLKLRLQLDDDTLEALKEDLIYAKHLGDG
Ga0222625_126943613300022195Groundwater SedimentMDYVAILEQVVALLQQEKRLSYRVLKLRLQLDEDTLEALK
Ga0212128_1062968513300022563Thermal SpringsMTYEEILTQVVALLQQEHRIAYRVLKRRLALEDDLLED
Ga0207670_1010936813300025936Switchgrass RhizosphereMDYDAIVIQALALLQREQRLSYRVLTLRLQLDDDTLE
Ga0207703_1112084813300026035Switchgrass RhizosphereMDYEAIVSQALALLQREQRLSYRVLKLRLHLDDDLLEALKEDLIY
Ga0207708_1179580113300026075Corn, Switchgrass And Miscanthus RhizosphereMDYDTVLAQVLALLQQEKRLSYRVLKLRFQLDDDTLEALKEDLVYAKQVAV
Ga0209180_1067168613300027846Vadose Zone SoilMDYDAVLAQVLALLQQEQRVAYRVLKRRLQLDDEILED
Ga0209814_1018932123300027873Populus RhizosphereMDYDAIVTQALTLLQRERRLAYRVLKLRLQIDDDLL
Ga0207428_1047849623300027907Populus RhizosphereMDYDAVLAQVVILLQQERRVAYRVLKRRLQLDDETLE
Ga0308204_1021165013300031092SoilMDYDEVVAQVVALLQREKRLSYRVLKLRLQLDDAILEA
Ga0308194_1030018423300031421SoilMDYDAVLAQVLSLLQQEQRLSYRVLKRRLHLDDDLLADLN
Ga0318573_1036107513300031564SoilMDYDAIVTQALALLQREQRLAYRVLKLRLQIDDDLLEALKDDLI
Ga0318542_1034188013300031668SoilMDYDAIVTQVLALLQREQRLAYRVLKLRLQIDDDLLEALKDD
Ga0318572_1088431823300031681SoilMDYDAIVTQALTLLQREQRLSYRVLKLRLQLDDDTLEALK
Ga0306917_1123090223300031719SoilMDYDAIVTQALTLLQRERRLAYRVLKLRLQIDDDLLEALKDDLI
Ga0318500_1040508313300031724SoilMDSDAIVTQALALLQREQRLAYRVLKLRLQIDDDLL
Ga0318500_1064081823300031724SoilMDYDAIVTQALTLLQREHRLSYRVLKLRLQLDDNMLE
Ga0318502_1070262613300031747SoilMDYDVVLAQVVALLQQEQRVAYRILKRRLQLDDETLE
Ga0318536_1069636113300031893SoilMDYDAIVTQALTLLQREQRLSYRVLKLRLQLDDDTLEALKED
Ga0306921_1226031913300031912SoilMDYDAIVTQALALLHREQRLAYRVLKLRLQIDDDLLEA
Ga0306921_1226956913300031912SoilMDYEAVLAQVLALLQQEQRLAYRVLKLRLQIDDDLLEALKDDLIYA
Ga0310916_1070356023300031942SoilMDYDALVTQALTLLQREQRLSYRVLKLRLQLDDDTLEALK
Ga0306926_1052464613300031954SoilMDYDAIVTQALALLQREQRLAYRVLKLRLQIDDDLLEALK
Ga0306926_1105499013300031954SoilMDYDAIVTQALTLLQREQRLSYRVLKLRLQLDDDLLEALK
Ga0306926_1248402513300031954SoilMDYQAVVAHVLALLQQEKRVAYRVLKRQLQLDDELLEDLKD
Ga0318531_1050774423300031981SoilMDYDALVTQALTLLQREQRLSYRVLKLRLQLDDDTLEALKEDL
Ga0307416_10312199223300032002RhizosphereMDYDAVLDQVVALLQQHKRLSSRVLTLRLQLDDNTLEALKEDLIYAKQ
Ga0310906_1038622113300032013SoilMDYDAVLAQVLDLLQREQRVAYRILKRRLQLDDETLE
Ga0318575_1069832623300032055SoilMDYDAIVTQALALLQREQRLSYRVLKLRLQIDDDLLEALKDDLIY
Ga0318514_1054068623300032066SoilMDYDAILAQVLALLQQEQRLSYRVLKRRLHLDDDL
Ga0306924_1196105313300032076SoilMDYDAVLAHVLELLQQEQRVAYRILKRRFALDDND
Ga0318525_1065187523300032089SoilMDYDAIVTQALTLLQRERRLAYRVLKLRLQIDDDLLEALK
Ga0307472_10012142123300032205Hardwood Forest SoilMDYDAIVTQALTLLQREQRLSYRVLKLRLQLDDDTL
Ga0306920_10125350113300032261SoilMDYDAIVTQALTLLQREQRLSYRVLKLRLQLDDDTLEALKE
Ga0306920_10173235723300032261SoilMDYDAIVTQALALLQREQRLAYRVLKLRLQIDDDL
Ga0306920_10182497823300032261SoilMDYDAVLAQVLALLQQEKRVAYRVLKRRLQLDDELLADL
Ga0310914_1082160023300033289SoilMDYDAVLAHVLALLQQEYRLSYRVLKLRLQLDDDLLEAL
Ga0364930_0235132_505_6213300033814SedimentMDYQAVLATVLALLQQEQRLSYRVLKLRLQLDDDTLEAL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.