NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F100777

Metagenome Family F100777

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100777
Family Type Metagenome
Number of Sequences 102
Average Sequence Length 49 residues
Representative Sequence MALRPAVIRDQDKIDVRLTSEAEYRIPFTFIEALNEGTLFDRPAHAFL
Number of Associated Samples 88
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 28.57 %
% of genes near scaffold ends (potentially truncated) 94.12 %
% of genes from short scaffolds (< 2000 bps) 89.22 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.176 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.647 % of family members)
Environment Ontology (ENVO) Unclassified
(29.412 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.137 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.58%    β-sheet: 8.33%    Coil/Unstructured: 77.08%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF07690MFS_1 6.86
PF03992ABM 4.90
PF00293NUDIX 3.92
PF01135PCMT 0.98
PF07883Cupin_2 0.98
PF13676TIR_2 0.98
PF00873ACR_tran 0.98
PF13847Methyltransf_31 0.98
PF13884Peptidase_S74 0.98
PF13193AMP-binding_C 0.98
PF13489Methyltransf_23 0.98
PF00903Glyoxalase 0.98
PF01510Amidase_2 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.98
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.98
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.98
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.18 %
UnclassifiedrootN/A8.82 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000890|JGI11643J12802_11295834All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300004463|Ga0063356_100586714All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1502Open in IMG/M
3300004479|Ga0062595_100136771All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1394Open in IMG/M
3300004479|Ga0062595_102623802All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium506Open in IMG/M
3300005337|Ga0070682_100662734All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium832Open in IMG/M
3300005340|Ga0070689_100070592All Organisms → cellular organisms → Bacteria2728Open in IMG/M
3300005347|Ga0070668_100972451All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium762Open in IMG/M
3300005354|Ga0070675_100850363All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium835Open in IMG/M
3300005455|Ga0070663_100472631All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1037Open in IMG/M
3300005518|Ga0070699_101369848All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300005548|Ga0070665_100880557All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium908Open in IMG/M
3300005577|Ga0068857_101949418All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium576Open in IMG/M
3300005577|Ga0068857_102095500All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium555Open in IMG/M
3300005598|Ga0066706_11142422All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium593Open in IMG/M
3300005764|Ga0066903_100775089Not Available1709Open in IMG/M
3300005764|Ga0066903_104543928All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300005764|Ga0066903_108915940All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium508Open in IMG/M
3300006046|Ga0066652_100360012Not Available1312Open in IMG/M
3300006796|Ga0066665_11316139All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium555Open in IMG/M
3300006914|Ga0075436_100742588All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria729Open in IMG/M
3300009094|Ga0111539_11462513All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300009147|Ga0114129_10979825All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300009162|Ga0075423_12290276All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium588Open in IMG/M
3300009162|Ga0075423_12859152All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300010303|Ga0134082_10500511All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium530Open in IMG/M
3300010325|Ga0134064_10497235Not Available505Open in IMG/M
3300010373|Ga0134128_10245543All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2009Open in IMG/M
3300010375|Ga0105239_10842946All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1051Open in IMG/M
3300010937|Ga0137776_1886395All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300012181|Ga0153922_1098547Not Available665Open in IMG/M
3300012205|Ga0137362_10766759All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300012207|Ga0137381_10339107All Organisms → cellular organisms → Bacteria1310Open in IMG/M
3300012208|Ga0137376_10976079All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium726Open in IMG/M
3300012285|Ga0137370_10748754All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium607Open in IMG/M
3300012285|Ga0137370_10765910All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300012357|Ga0137384_11556351All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium511Open in IMG/M
3300012582|Ga0137358_10992664All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium544Open in IMG/M
3300012922|Ga0137394_11568213All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300012924|Ga0137413_10035316All Organisms → cellular organisms → Bacteria2785Open in IMG/M
3300012929|Ga0137404_10003542All Organisms → cellular organisms → Bacteria10412Open in IMG/M
3300012929|Ga0137404_10055139All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus3063Open in IMG/M
3300012929|Ga0137404_12228240All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300012957|Ga0164303_10105345All Organisms → cellular organisms → Bacteria1407Open in IMG/M
3300012960|Ga0164301_11799245All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300012961|Ga0164302_11230350All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium600Open in IMG/M
3300012971|Ga0126369_11957290All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium674Open in IMG/M
3300012985|Ga0164308_10456017All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300012987|Ga0164307_11118507All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium648Open in IMG/M
3300012988|Ga0164306_10244201All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300012989|Ga0164305_11075620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales689Open in IMG/M
3300013306|Ga0163162_11190516All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium864Open in IMG/M
3300014325|Ga0163163_10419102All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1398Open in IMG/M
3300014969|Ga0157376_13007627All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium510Open in IMG/M
3300015359|Ga0134085_10136973All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1034Open in IMG/M
3300015371|Ga0132258_13501784All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1075Open in IMG/M
3300015373|Ga0132257_100871313All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300015373|Ga0132257_103614871All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300015373|Ga0132257_103841340All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium547Open in IMG/M
3300016357|Ga0182032_11200735All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium653Open in IMG/M
3300016371|Ga0182034_11941320All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium520Open in IMG/M
3300017944|Ga0187786_10532463All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium539Open in IMG/M
3300018028|Ga0184608_10013489All Organisms → cellular organisms → Bacteria2839Open in IMG/M
3300018031|Ga0184634_10380795All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium646Open in IMG/M
3300018051|Ga0184620_10274025All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium567Open in IMG/M
3300018061|Ga0184619_10313025All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium719Open in IMG/M
3300018072|Ga0184635_10406560All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300018482|Ga0066669_11109305All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium714Open in IMG/M
3300019356|Ga0173481_10231696All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300019885|Ga0193747_1076131All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium827Open in IMG/M
3300019886|Ga0193727_1064276All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1150Open in IMG/M
3300019886|Ga0193727_1147287All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium644Open in IMG/M
3300020006|Ga0193735_1118626All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium721Open in IMG/M
3300020022|Ga0193733_1090049All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium859Open in IMG/M
3300021080|Ga0210382_10304329All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium701Open in IMG/M
3300025315|Ga0207697_10097060All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1253Open in IMG/M
3300025898|Ga0207692_10894393All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300025905|Ga0207685_10610360All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium586Open in IMG/M
3300025916|Ga0207663_10789683All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium756Open in IMG/M
3300025929|Ga0207664_10308103All Organisms → cellular organisms → Bacteria1395Open in IMG/M
3300025930|Ga0207701_10075425All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium3058Open in IMG/M
3300025935|Ga0207709_10799787All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300026329|Ga0209375_1235214All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium631Open in IMG/M
3300027502|Ga0209622_1072808Not Available627Open in IMG/M
3300028379|Ga0268266_10287366All Organisms → cellular organisms → Bacteria1531Open in IMG/M
3300028807|Ga0307305_10234088All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium841Open in IMG/M
3300028807|Ga0307305_10299144All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300028819|Ga0307296_10175816All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1160Open in IMG/M
3300028819|Ga0307296_10570998All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium619Open in IMG/M
3300031231|Ga0170824_105348569All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300031446|Ga0170820_15263659All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300031474|Ga0170818_100316247All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium636Open in IMG/M
3300031474|Ga0170818_113280197All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300031720|Ga0307469_10629435All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300031820|Ga0307473_10305287All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1004Open in IMG/M
3300031858|Ga0310892_11158634All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium550Open in IMG/M
3300031910|Ga0306923_10565986All Organisms → cellular organisms → Bacteria1279Open in IMG/M
3300031946|Ga0310910_10310180All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300032076|Ga0306924_11309161All Organisms → cellular organisms → Bacteria778Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.65%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.76%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.88%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.90%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.96%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.96%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.98%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.98%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.98%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.98%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.98%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300012181Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaGHost-AssociatedOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11643J12802_1129583423300000890SoilMALRPSVIRDQDRIDVRLTEEAEYRIPFTFIEALNE
Ga0063356_10058671423300004463Arabidopsis Thaliana RhizosphereMALRPAVIRDQDRIDVRLTEEAEYRIPFTFIEALNEGTLFDRPAHAF
Ga0062595_10013677133300004479SoilMTLRPAVIRDQDRIDVRLTSEAEYLIPFTFIEALNEGTLFDRPAHAFLDAARERRLF
Ga0062595_10262380223300004479SoilMVLRPSVIRDQDRIDVRLTKEAEYRIPFTFIEALNEGTLFDRPAHAFLD
Ga0070682_10066273413300005337Corn RhizosphereMALRPSVIRDQDRIDVRLTEEAEYRIPFTFIEALNEGTLFDRPA
Ga0070689_10007059253300005340Switchgrass RhizosphereMALRPAVIRDQDRIDVRLTGEAEYLIPFTFIEALNEGTLF
Ga0070668_10097245123300005347Switchgrass RhizosphereMSVRPPVIRDQDKIDVRLTGEDEYLIPFTFIEALNEGTLFDRPA
Ga0070675_10085036313300005354Miscanthus RhizosphereMALRPSVIRDQDRIDVRLTEEAEYRIPFTFIEALNEGTLFDRPAHAFLEAARER
Ga0070663_10047263113300005455Corn RhizosphereMSVRPPVIRDQDKIDVRLTGEAEYLIPFTFIEALNEGTLFDRPAHA
Ga0070699_10136984823300005518Corn, Switchgrass And Miscanthus RhizosphereMSVRPPVIRDQDKINVRLTGEAEYRIPFTFIEALNEGTLFD
Ga0070665_10088055733300005548Switchgrass RhizosphereMGSRPSVIRDQDRIDVRLTEEAEHLIPFTFIEALNEGTLFDRPA
Ga0068857_10194941813300005577Corn RhizosphereMSVRPPVIRDQDKIDVRLTGEAEYLIPFTFIEALNEGTLFDRPAHAFLDAARER
Ga0068857_10209550023300005577Corn RhizosphereMALRPSVIRNQDRIDVRLTEEAEYRIPFTFIEALNE
Ga0066706_1114242223300005598SoilMSVRPPVIRDQDRIDVRLTGEAEYLIPFTFIEALNEGTLFDRPAHAF
Ga0066905_10189509613300005713Tropical Forest SoilMVHRPAIISDQDKVEIRLTSEAEYRLPFTFIEALNEGTLFDRPAHVFRDAA
Ga0066903_10077508913300005764Tropical Forest SoilMAFRPPVIRDQDRIDVRLTGEDDYRIPFTFIEALNEGTLFDR
Ga0066903_10454392813300005764Tropical Forest SoilMALRPAVIRDQDKIDVRLTSEAEYLIPFTFIEALNEGTL
Ga0066903_10891594013300005764Tropical Forest SoilMALRPPVIRDQDRIDVRLTGEDDYRIPFTFIEALNEGT
Ga0066652_10036001243300006046SoilMALRPPVIRDQDRIDVRLTGEAEYRIPFTFIEALNE
Ga0066665_1131613923300006796SoilMALRPSVIRDQDRIDVRLTSEAEYRIPFTFIEALNEGTLFDRP
Ga0075425_10156231513300006854Populus RhizosphereMIHRPPVVTDEDRIEIRLTPESEYRVPYTFVEALNEGTLFDRPAHVFREA
Ga0075436_10074258813300006914Populus RhizosphereMVHRPAMIRDQDRVEIRLTHEAEYRLPFTFIEALNEGTLFDRPAHVFRDA
Ga0111539_1146251313300009094Populus RhizosphereVASSKWLLDRQSFRDQDRIDVRLTSEAEYLIPFTFIEALNEGTLFDRPAHAFLDAARERRLFHVLN
Ga0114129_1097982523300009147Populus RhizosphereMALRPPVIRDQDRIDVRLTSEAEYLIPFTFIEALNEGTLFDRPAHAFLDAARERRLF
Ga0075423_1229027623300009162Populus RhizosphereMALRPSVIRDQDRIDVRLTGEAEYRIPFTFIEALNEGTLF*
Ga0075423_1285915213300009162Populus RhizosphereMSVRPPVVRDQDKIDVRLTGEDEYLIPFTFIEALNEGTLFDRP
Ga0134082_1050051113300010303Grasslands SoilMALRPAVIRDQDRIDVRLTSEAEYRIPFTFIEALNEGTLFDRPAEAF
Ga0134064_1049723513300010325Grasslands SoilMALRPPVIRDQDRIDVRLTGEAEYRIPFTFIEALNEGTLFDRPA
Ga0134128_1024554313300010373Terrestrial SoilMALRPAVIRDQDRIDVRLTGEAEYLIPFTFIEALNEGTLFDRPAHAFLKAAQERRL
Ga0105239_1084294613300010375Corn RhizosphereMDPRPPVVRDQDRIDVRLTGEAEYLIPFTFIEALNEGTLFDRPAHAFL
Ga0137776_188639523300010937SedimentMLVNRPPVIRDGDKIDFRLTEETEYRIPFTFIEALNEGTLADRPA
Ga0153922_109854713300012181Attine Ant Fungus GardensMPVNRPPVIRDRDKIDFRLTEETEYRIPFTFIEALNEGTLADRPAHAFLDAARERRLF
Ga0137362_1076675923300012205Vadose Zone SoilMALRPSVIRDQDRIDVRLTSEADYRIPFTFIEALNEGTLFDRPAHAFLDAARERRLF
Ga0137381_1033910713300012207Vadose Zone SoilMASRPAVIRDQDRIDVRLTGEAEYRIPFTFIEALKEGTLFD
Ga0137376_1097607913300012208Vadose Zone SoilMPLRPALIRDQDKIDVRLTSEAEYRIPFTFIEALNEGTVFDRPAEAFLDAARERRLFH
Ga0137370_1074875413300012285Vadose Zone SoilMPLRPAVIRDQDRIDVRLTSEAEYRIPFTFIEALNEGTLFD
Ga0137370_1076591023300012285Vadose Zone SoilMDPRPPVIRDQDRIDVRLTGEAEYRIPFTFIEALN
Ga0137384_1155635113300012357Vadose Zone SoilMDPRPPVIRDQDKIDVRLTGEAEYRIPFTFIEALNEGTLFDRPAH
Ga0137358_1099266423300012582Vadose Zone SoilMSVRPPVIRDQDRIDVRLTSEAEYRIPFTFIEALNEGTLFDRPAHAFLDAARERRLFHVLNRTTDNI
Ga0137394_1156821323300012922Vadose Zone SoilMALRPAVIRDQDKIDVRLTSEAEYRIPFTFIEALNE
Ga0137413_1003531653300012924Vadose Zone SoilMALRPAVIRDQDKIDVRLTVEAEYRIPFTFIEALNEGTLFDRPAEAFLEAARERRLF
Ga0137404_1000354283300012929Vadose Zone SoilMALRPSVIRDQDRIDVRLTSEAEYRIPFTFIEALNEGTLFDRPAHAFLDAARERRLFHVL
Ga0137404_1005513913300012929Vadose Zone SoilMALRPSVIRDQDTIDVRLTGEAEYRIPFTFIEALNEGTLFDRPAHAFLEAARERRLFQV
Ga0137404_1222824013300012929Vadose Zone SoilMALRPAVIRDQDKIDVRLTSEAEYRIPFTFIEALNEGTLFD
Ga0164303_1010534533300012957SoilMPLRPAVVRDQDKIDVRLTSEAEYRIPFTFIEALNEGTLFDRPAHAFLEAARERRLFQVMNRTTD
Ga0164301_1179924523300012960SoilMSVRPPVIRDQDQIDVRLTSEAEYLIPFTFIEALNEGTLFDRPAHAFLEAARERRLFQVL
Ga0164302_1123035013300012961SoilMSVRPPVIRDQDQIDVRLTSEAEYLIPFTFIEALNEGTLFDRPAHAFLEAARERRLFHV
Ga0126369_1195729023300012971Tropical Forest SoilMALRPAVIRDQDRIDVRLTGEAEYLIPFTFIEALNEGTLFDRPAHAFLEAARERRLFHVLNRATDN
Ga0164308_1045601713300012985SoilMSVRPPVIRDQDQIDVRLTSEAEYLIPFTFIEALNEGTL
Ga0164307_1111850723300012987SoilMPLRPAVVRDQDKIDVRLTSEAEYRIPFTFIEALNEGTLFDRPAHAFLDA
Ga0164306_1024420113300012988SoilMSVRPAVIRDQDKIDVRLTSEAEYLIPFTFIEALNEGTLFDRPAHAFLEAARERRLFQVLNR
Ga0164305_1107562013300012989SoilMIHRPPVVRDQDIIEIRLTPESEYRIPFTFIEALNEGTLFD
Ga0163162_1119051613300013306Switchgrass RhizosphereMALRPAVIRDQDKIDVRLTSEAEYRIPFTFIEALNEGTLFDRPAHAFL
Ga0163163_1041910213300014325Switchgrass RhizosphereMALRPSVIRDQDKIDVRLTEEAEYRIPFTFIEALNEGTLFD
Ga0157376_1300762723300014969Miscanthus RhizosphereMDPRPPVVRDQDRIDVRLTGEAEYLIPFTFIEALNEGTLFDRPAHAFLEA
Ga0134085_1013697333300015359Grasslands SoilMALRPAVIRDQDRIDVRLTSEAEYRIPFTFIEALNEGTLFDRPAEAFLNAARERRLFHVL
Ga0132258_1350178413300015371Arabidopsis RhizosphereMALRPSVIRDQDKIDVRLTSEAEYRIPFTFIEALNEGTLFDRPAHAFLDAARE
Ga0132257_10087131333300015373Arabidopsis RhizosphereMPLRPAVVRDQDKIDVRLTSEAEYRIPFTFIEALNEGTLFDRPAHAFLEA
Ga0132257_10361487123300015373Arabidopsis RhizosphereMALRPLVIKDQDRIDVRLTGEAEYRIPFTFIEALNEGTLFDRPAHAFLEAARERRLFHVL
Ga0132257_10384134023300015373Arabidopsis RhizosphereMAPRPPVIRDQDRIDVRLTGEAEYRIPFTFIEALNEG
Ga0182032_1120073523300016357SoilMALRPPVIRDQDRIDVRLTGEDDYRIPFTFIEALNEGTLFDRP
Ga0182034_1194132013300016371SoilMALRPAVIRDQDRIDVRLTGEAEYMIPFTFIEALNEGTLFDRPAHAFLDAARERRLFHV
Ga0187786_1053246313300017944Tropical PeatlandMSVRPPVIRDQDKIDVRLTSEAEYRIPFTFIEALNEGTLFDRPEHAFLEAARERRLF
Ga0184608_1001348933300018028Groundwater SedimentMSVRPPVIRDQDRIDVRLTSEAEYRIPFTFIEALNEGTLFDRPAEAFLDAARER
Ga0184634_1038079513300018031Groundwater SedimentMALRPAVIRDQDRIDVRLTSEAEYRIPFTFIEALNEGTLFDRPAQAFLEAARERRLFHVLNRTTDNI
Ga0184620_1027402513300018051Groundwater SedimentMALRPAVIRDQDRIDVRLTGEAEYRIPFTFIEALNEGTLFDRPAHAFLEAAR
Ga0184619_1031302513300018061Groundwater SedimentMALRPPVIRDQDRIDVRLTGEAEYLIPFTFIEALNEGTLFD
Ga0184635_1040656023300018072Groundwater SedimentMSVRPPVIRDQDRIDVRLTSEAEYRIPFTFIEALNEGTLFDRPAQAFLDAAREHRLFHVLNRTTDN
Ga0066669_1110930523300018482Grasslands SoilMARPPVIRDQDRIDVRLTGEAEYRILFTFIEALNEGTLFDRPAHAFLEAARDRRLFHVLN
Ga0173481_1023169623300019356SoilMALRPAVVRDQDRIDVRLTGEAEYRIPFTFIEALNEGTLFDR
Ga0193747_107613113300019885SoilMALRPAVIRDQDKIDVRLTGEAEYRIPFTFIEALNEGTLFDRPAH
Ga0193727_106427643300019886SoilMALRPAVIRDQDKIDVRLTSEAEYRIPFTFIEALNEGTLFDRPAH
Ga0193727_114728723300019886SoilMSVRPAVIRDQDKIDVRLTSEAEYRIPFTFIEALNEGTLFDRPAEAF
Ga0193735_111862623300020006SoilMALRPSVIRDQDKIDVRLTSEAEYRIPFTFIEALNEGTLF
Ga0193733_109004913300020022SoilMALRPAVIRDQDKIDVRLTSEAEYLIPFTFIEALNEGTLFDRPAHAFLDAARE
Ga0210382_1030432923300021080Groundwater SedimentMSVRPAVIRDQDKIDVRLTSEAEYRIPFTFIEALNEGTLFDRPAEAFLDAARERRLFHV
Ga0207697_1009706033300025315Corn, Switchgrass And Miscanthus RhizosphereMALRPSVIRDQDRIDVRLTEEAEYRIPFTFIEALNEGTLFDRPAHA
Ga0207692_1089439313300025898Corn, Switchgrass And Miscanthus RhizosphereMPVNRPSVIRDQDKIDFRLTEEAEYRIPFTFIEALNEGTLADRP
Ga0207685_1061036013300025905Corn, Switchgrass And Miscanthus RhizosphereMALRPSVIRDQDRIDVLLTGEAEYRIPFTFIEALN
Ga0207663_1078968313300025916Corn, Switchgrass And Miscanthus RhizosphereMDPRPPVIRDQDKIDVRLTGEAEYRIPFTFIEALNEGTLFDRPAQAFLDAARER
Ga0207664_1030810333300025929Agricultural SoilMPVNTPSVIRDQDKIDFRLTEEAEYRIPFTFIEALNEGTLADRPAHAFLDA
Ga0207701_1007542553300025930Corn, Switchgrass And Miscanthus RhizosphereMDPRPPVVRDQDRIDVRLTGEAEYLIPFTFIEALNEGTLFDRPAHAFLD
Ga0207709_1079978713300025935Miscanthus RhizosphereMVLRPAVIRDQDRIDVRLTGESEYRIPFTFIEALNEGTLFDRPAQAFL
Ga0209375_123521413300026329SoilMALRPAVIRDQDRIDVRLTGEAEYLIPFTFIEALNEGTL
Ga0209622_107280823300027502Forest SoilMPVNRPSVIRDQDKIDFRLTEEAEYRIPFTFIEALNEGTLADRPAHAF
Ga0209329_102599423300027605Forest SoilMIHRPPVVRDQDIIEIRLTPESEYRIPFTFIEALNEGTLFDRPAHVFREAARE
Ga0268266_1028736623300028379Switchgrass RhizosphereMALRPPVIRDQDRIDVRLTGESEYRIPFTFIEALNEGTLFDRPAQAFLDAARERRL
Ga0307316_1029440723300028755SoilMVHRPAMIRDQDKIEIRLTREAEYRLPFTFIEALNEGTLFDRPAHVFRDAA
Ga0307305_1023408813300028807SoilMALRPAVIRDQDRIDVRLTSEAEYRIPFTFIEALNEGTLFDRPAHAFLDAARE
Ga0307305_1029914413300028807SoilMSVRPPVIRDQDRIDVRLTSEAEYRIPFTFIEALNEGTLFDRPEHAFLD
Ga0307296_1017581633300028819SoilMSVRPAVIRDQDRIDVRLTSEAEYRIPFTFIEALNEGTLFDRPAEAFLDAARERRL
Ga0307296_1057099823300028819SoilMSVRPAVIRDQDKIDVRLTSEAEYRIPFTFIEALNEGTL
Ga0170824_10534856913300031231Forest SoilMDPKPPVIRDQDKIDVRLTGEADYRIPFTFIEALNEGTLFDRPAHAFLDAAREHRLFH
Ga0170820_1526365923300031446Forest SoilMALRPAVVRDQDRIDVRLTGEAEYLIPFTFIEALNEGTLFDRPAHAFLDAARERRLFHVLNRTTGN
Ga0170818_10031624713300031474Forest SoilMDPKPPVIRDQDKIDVRLTGEADYRIPFTFIEALNEGTLFDRPAHAFLDAARE
Ga0170818_11328019723300031474Forest SoilMALRPAVVRDQDRIDVRLTGEAEYLIPFTFIEALNEGTLFDRPAHAFLDAARERRLFHV
Ga0307469_1062943513300031720Hardwood Forest SoilMSVRPAVIRDQDRIDVRLTSESEYLIPFTFIEALNEGTLFDRP
Ga0307473_1030528723300031820Hardwood Forest SoilMSVRPAVIRDQDKIDVRLTGEAEYLIPFTFIEALNEGTLFDRPAHAFLEAA
Ga0310892_1115863413300031858SoilMALRPSVIRDQDKIDVRLTGEAEYRIPFTFIEALNEGTLFD
Ga0306923_1056598623300031910SoilMALRPAVIRDQDRIDVRLTGEAEYMIPFTFIEALNEGTLFDRPAHAFLDAA
Ga0310910_1031018013300031946SoilMALRPAVIRDQDRIDVRLTGEAEYMIPFTFIEALNEGTL
Ga0306924_1130916143300032076SoilMVLRPPVVKDQDRIDVRLTGEAEYQIPFTFIEALNEGTLFDRPAHAFLDAAGERRLFHVL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.