NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F100766

Metagenome Family F100766

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100766
Family Type Metagenome
Number of Sequences 102
Average Sequence Length 41 residues
Representative Sequence TIVYPAGYEIRDREYRLVGNPTIPRDVVRAALHEMSRFYR
Number of Associated Samples 88
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.00 %
% of genes near scaffold ends (potentially truncated) 92.16 %
% of genes from short scaffolds (< 2000 bps) 86.27 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.118 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(30.392 % of family members)
Environment Ontology (ENVO) Unclassified
(41.176 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(42.157 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.06%    β-sheet: 5.88%    Coil/Unstructured: 72.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF11893DUF3413 33.33
PF0209660KD_IMP 9.80
PF08450SGL 1.96
PF00753Lactamase_B 1.96
PF13537GATase_7 1.96
PF07578LAB_N 0.98
PF13586DDE_Tnp_1_2 0.98
PF03544TonB_C 0.98
PF07978NIPSNAP 0.98
PF14849YidC_periplas 0.98
PF10081Abhydrolase_9 0.98
PF13522GATase_6 0.98
PF01594AI-2E_transport 0.98
PF00296Bac_luciferase 0.98
PF00691OmpA 0.98
PF00933Glyco_hydro_3 0.98
PF07690MFS_1 0.98
PF00884Sulfatase 0.98
PF00561Abhydrolase_1 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0706Membrane protein insertase Oxa1/YidC/SpoIIIJCell wall/membrane/envelope biogenesis [M] 9.80
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 1.96
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 1.96
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.98
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.98
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 0.98
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.98
COG3952Uncharacterized N-terminal domain of lipid-A-disaccharide synthaseGeneral function prediction only [R] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.12 %
UnclassifiedrootN/A5.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573000|GPBTN7E01EESGNAll Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium517Open in IMG/M
2199352025|deepsgr__Contig_14728All Organisms → cellular organisms → Bacteria1577Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104550317All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300000955|JGI1027J12803_101887207All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium787Open in IMG/M
3300000956|JGI10216J12902_101877699All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2319Open in IMG/M
3300000956|JGI10216J12902_109956987All Organisms → cellular organisms → Bacteria1762Open in IMG/M
3300004062|Ga0055500_10005804All Organisms → cellular organisms → Bacteria1874Open in IMG/M
3300005172|Ga0066683_10293410All Organisms → cellular organisms → Bacteria1010Open in IMG/M
3300005218|Ga0068996_10009561All Organisms → cellular organisms → Bacteria1322Open in IMG/M
3300005444|Ga0070694_100011433All Organisms → cellular organisms → Bacteria → Proteobacteria5497Open in IMG/M
3300005446|Ga0066686_10742753All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300005467|Ga0070706_100078774All Organisms → cellular organisms → Bacteria3050Open in IMG/M
3300005468|Ga0070707_101942359All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300005518|Ga0070699_100748579All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300005540|Ga0066697_10506369All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300005546|Ga0070696_101503418All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300005558|Ga0066698_10880819All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300005764|Ga0066903_106703238All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300006797|Ga0066659_10358358All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300006852|Ga0075433_11120034All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300006904|Ga0075424_102681357All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300007255|Ga0099791_10091176All Organisms → cellular organisms → Bacteria1396Open in IMG/M
3300007255|Ga0099791_10233382All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300009012|Ga0066710_104265177All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium534Open in IMG/M
3300009038|Ga0099829_10006722All Organisms → cellular organisms → Bacteria → Proteobacteria7128Open in IMG/M
3300009038|Ga0099829_11632724All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300009088|Ga0099830_10353702All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300009088|Ga0099830_10486315All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300009089|Ga0099828_10014712All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5943Open in IMG/M
3300009137|Ga0066709_100870365All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1311Open in IMG/M
3300009147|Ga0114129_10991155Not Available1059Open in IMG/M
3300009837|Ga0105058_1142865All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300010046|Ga0126384_10137827All Organisms → cellular organisms → Bacteria1862Open in IMG/M
3300010336|Ga0134071_10171949All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300010337|Ga0134062_10673032All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300010362|Ga0126377_13004473All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300010366|Ga0126379_12622252All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium601Open in IMG/M
3300010373|Ga0134128_11868111All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300010376|Ga0126381_101518728All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium968Open in IMG/M
3300012189|Ga0137388_10678376All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300012201|Ga0137365_10170138All Organisms → cellular organisms → Bacteria1633Open in IMG/M
3300012201|Ga0137365_11034296All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium594Open in IMG/M
3300012209|Ga0137379_10528693All Organisms → cellular organisms → Bacteria1087Open in IMG/M
3300012354|Ga0137366_10250686All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1312Open in IMG/M
3300012354|Ga0137366_10439502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales947Open in IMG/M
3300012356|Ga0137371_10805462All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300012362|Ga0137361_10555101All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300012362|Ga0137361_10812840All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium850Open in IMG/M
3300012922|Ga0137394_10040183All Organisms → cellular organisms → Bacteria → Proteobacteria3832Open in IMG/M
3300012922|Ga0137394_10733359All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300012922|Ga0137394_11469744All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300012930|Ga0137407_10323020All Organisms → cellular organisms → Bacteria1416Open in IMG/M
3300012944|Ga0137410_10159431All Organisms → cellular organisms → Bacteria1725Open in IMG/M
3300012944|Ga0137410_10221915All Organisms → cellular organisms → Bacteria1471Open in IMG/M
3300012944|Ga0137410_10841985All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300012948|Ga0126375_11955750All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae517Open in IMG/M
3300012976|Ga0134076_10342608All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300013001|Ga0157365_10182720All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300014882|Ga0180069_1133905Not Available602Open in IMG/M
3300014883|Ga0180086_1190912All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300015372|Ga0132256_103080284All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium560Open in IMG/M
3300015373|Ga0132257_100036273All Organisms → cellular organisms → Bacteria5400Open in IMG/M
3300018071|Ga0184618_10058882All Organisms → cellular organisms → Bacteria1417Open in IMG/M
3300018077|Ga0184633_10190120All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300018079|Ga0184627_10106048All Organisms → cellular organisms → Bacteria1485Open in IMG/M
3300019872|Ga0193754_1020790All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300019881|Ga0193707_1075127All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300019882|Ga0193713_1006464All Organisms → cellular organisms → Bacteria3653Open in IMG/M
3300019997|Ga0193711_1005008All Organisms → cellular organisms → Bacteria1655Open in IMG/M
3300021063|Ga0206227_1116278All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria535Open in IMG/M
3300022534|Ga0224452_1051244All Organisms → cellular organisms → Bacteria1227Open in IMG/M
3300024330|Ga0137417_1305922All Organisms → cellular organisms → Bacteria3897Open in IMG/M
3300025167|Ga0209642_10126778All Organisms → cellular organisms → Bacteria1478Open in IMG/M
3300025549|Ga0210094_1019655All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300026313|Ga0209761_1304406All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300026315|Ga0209686_1191538All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300026317|Ga0209154_1308342All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300026318|Ga0209471_1013331All Organisms → cellular organisms → Bacteria4262Open in IMG/M
3300026538|Ga0209056_10593272All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300027181|Ga0208997_1028026All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300027655|Ga0209388_1214682All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300027846|Ga0209180_10460297All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300027875|Ga0209283_10422559All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300027882|Ga0209590_10304336All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300028380|Ga0268265_10047075All Organisms → cellular organisms → Bacteria3229Open in IMG/M
3300028381|Ga0268264_11859292All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300028536|Ga0137415_10823085All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium739Open in IMG/M
3300028784|Ga0307282_10257350All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300028828|Ga0307312_10009120All Organisms → cellular organisms → Bacteria → Proteobacteria5435Open in IMG/M
3300028828|Ga0307312_10810503All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300031184|Ga0307499_10246056Not Available569Open in IMG/M
3300031720|Ga0307469_10191407All Organisms → cellular organisms → Bacteria1586Open in IMG/M
3300031873|Ga0315297_11039843All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300032174|Ga0307470_10871433All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300032180|Ga0307471_100298213All Organisms → cellular organisms → Bacteria1697Open in IMG/M
3300032180|Ga0307471_101527078Not Available825Open in IMG/M
3300032205|Ga0307472_101614159All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300032516|Ga0315273_10665451All Organisms → cellular organisms → Bacteria1373Open in IMG/M
3300033500|Ga0326730_1015882All Organisms → cellular organisms → Bacteria1604Open in IMG/M
3300034178|Ga0364934_0409962All Organisms → cellular organisms → Bacteria513Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil30.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.90%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.90%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.94%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.94%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.96%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.98%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.98%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.98%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.98%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.98%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.98%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.98%
Fungus GardenHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004062Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005218Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300013001Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta sexdens ASBM3Host-AssociatedOpen in IMG/M
3300014882Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300019872Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019997Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2EnvironmentalOpen in IMG/M
3300021063Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025549Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027181Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033500Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fractionEnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N55_077703802189573000Grass SoilLPSSYEIRDRNYRLVPKPTLPRDVVQAALREMSRFYR
deepsgr_024170302199352025SoilVTVVLPSSYEIRDRNYRLVPKPTLPRDVVQAALKEMSRFYR
INPhiseqgaiiFebDRAFT_10455031713300000364SoilVVFPAGYEIRDRSYRLVANPTLPRDGLRAAMHEMSRFYR*
JGI1027J12803_10188720723300000955SoilPAGYEIRDRRDRLETHPTLPRDALRSAVQEMSRFYR*
JGI10216J12902_10187769933300000956SoilVVLQDAYEIRDANYRLVRHPTLPRDGLRAALREMSRFYK*
JGI10216J12902_10995698713300000956SoilVHPAGYEIRDRDYRLVGHPTIPRDVVRAALHEMRRFDR*
Ga0055500_1000580423300004062Natural And Restored WetlandsTIVYPASYEIRDRDYRLVAHPMLPRDSLRAAQREMSRFFR*
Ga0066683_1029341013300005172SoilTIVYPAGYEIRDREYRLVGNPTIPRDVVRAALHEMSRFYR*
Ga0068996_1000956123300005218Natural And Restored WetlandsTIVYPASYEIRDRDYRLVAHPTPPRDSLRAAQKEMSRFFR*
Ga0070694_10001143363300005444Corn, Switchgrass And Miscanthus RhizosphereVTIVYPASYEIRDRAYRLVAHPTLPREGLRGAQKEMSRFYR*
Ga0066686_1074275313300005446SoilIVHPAGYEIRDREYRLVANPTIPREVVRAALHEMSRFYR*
Ga0070706_10007877433300005467Corn, Switchgrass And Miscanthus RhizosphereLIEPERVTIVYPAGYEIRDRDYGLVRNPTIPRDVVRPALHEMSRFYR*
Ga0070707_10194235923300005468Corn, Switchgrass And Miscanthus RhizosphereTVVFPAGYEIRDRSYRLVANPTFPRDGLRAALHEMSRFYR*
Ga0070699_10074857913300005518Corn, Switchgrass And Miscanthus RhizosphereLIEPDRVTVVFPAGYEIRDQSYRLVANPTLPRDGLRAAMHEMSRFYR*
Ga0066697_1050636923300005540SoilTIVYPAGYEIRDREYRLVGNPTIPRAVVRAALHEMSRFYR*
Ga0070696_10150341823300005546Corn, Switchgrass And Miscanthus RhizosphereEPERLIIIRPSGQEVRDRTYRLVANPTLPRDALQAALREMSRFSR*
Ga0066698_1088081923300005558SoilVIEPERVTVIYPASYEIRDRSYRLVPNPTVPRDVLRGALQEMSRFY
Ga0066903_10670323813300005764Tropical Forest SoilRVIVVLPAGYEIRDRTYRLVSNPALPRDALRAAMREMSRFYR*
Ga0066659_1035835813300006797SoilGYEIRDRNYRLVQKPKIPHDALRAALQEMRRFYR*
Ga0075433_1112003423300006852Populus RhizosphereTIVYPAGYQIRDRDYRLVRNPTIPREVVRAALHEMSRFYR*
Ga0075424_10268135713300006904Populus RhizosphereLQDAYEVRDGNYRLLPHPTLPRDGLRAALREMSRFYK*
Ga0099791_1009117623300007255Vadose Zone SoilTVVFPAGYEIRDRSYRLVANPTLPRDGLRAAMHEMSRFYR*
Ga0099791_1023338213300007255Vadose Zone SoilPAGYEIRDREYRLVANPTIPRDVVRAALHEMSRFYR*
Ga0066710_10426517723300009012Grasslands SoilGGYEIRDENYRLVRHPTLPQESLRAALREMSRFYR
Ga0099829_1000672273300009038Vadose Zone SoilIVYPAGYEIRDRDYRLVGHPTIPREVVRAALHEMSRFYR*
Ga0099829_1163272413300009038Vadose Zone SoilVTVVFPSGYEIRDRNYRLVSNPTFPRESLRAAGHTMRRFYR*
Ga0099830_1035370213300009088Vadose Zone SoilIVYPASYEIRDRDYRLVAHPTFPRAGLGAAQQEMSRFFR*
Ga0099830_1048631523300009088Vadose Zone SoilIEPERVTIVYPAGYEIRARDYRLVGHPTIPREVVRAALHEMSRFYR*
Ga0099828_1001471263300009089Vadose Zone SoilTIVYPAGYEIRDRDYRLVGHPTIPREVVRAALHEMSRFYR*
Ga0099828_1122370023300009089Vadose Zone SoilSRGYEIRDENYRLILHATFPQERLRAALREMSRFYR*
Ga0066709_10087036533300009137Grasslands SoilLIEPDRITVVFPAGYEIRDRNYRLLQHPTLPRDGLRAALHEMSRFYR*
Ga0114129_1099115513300009147Populus RhizosphereTVVFRSGYEIRDGRYRLLPHPTLPRDLVRSAMHEMSRFYR*
Ga0105058_114286513300009837Groundwater SandSYEIRDRSYRLVPKPTIPRDALRAALQEMSRFYR*
Ga0126384_1013782733300010046Tropical Forest SoilVTLVLPAGYEIRDRRYRLMTHPALPREALRSAVQEMSRFYR*
Ga0134071_1017194923300010336Grasslands SoilFALIEPGRVTVVFPSGYEIRDGNYRLVPNPTLPRGLVRDAMHEMSRFYR*
Ga0134062_1067303213300010337Grasslands SoilVTIAYPAGYEIRDRNYRLVQKPKIPHDALRAALQEMRRFYR*
Ga0126377_1300447313300010362Tropical Forest SoilSYRDYALVDPERVTLVLPAGYEIRDRRYRLMTHPALPREALRSAVQEMSRFYR*
Ga0126379_1262225213300010366Tropical Forest SoilIEPDRVTVVFGSGYEIRDRRYRLVPNPTLPRDLLRAAMHEMSRFYR*
Ga0134128_1186811123300010373Terrestrial SoilEFALIEPERVTIVYPASYEIRDRAYRLVAHPTLPREGLRGAQKEMSRFYR*
Ga0126381_10151872833300010376Tropical Forest SoilFGSGYEIRDGRYQLVPNPTLPRDLLRSAMHEMSRFYR*
Ga0137388_1067837623300012189Vadose Zone SoilGYEIRDRSYRLVANPTLPRDGLRAALHEMSRFYR*
Ga0137365_1017013823300012201Vadose Zone SoilVTIVYPAGYEIRDREYRLVGNPTIPRDVVRAALHEMSRFYR*
Ga0137365_1103429613300012201Vadose Zone SoilLIEPERVTIVRPNGYEIRDRGYRLIPNPTVPRDVVRAALHEMRRFYR*
Ga0137379_1052869313300012209Vadose Zone SoilDYALLEAERVTIVYPAGYEIRDRDYRLIEHPTLPRESLRAALGEMSRFYR*
Ga0137366_1025068623300012354Vadose Zone SoilVTVVFQDAYEVRDGNYRLVPNPTLPRDGLRAALREMSRFYK*
Ga0137366_1043950213300012354Vadose Zone SoilIVSPTSYELRDRKYRLIPNPAPPRDHLRAAMHEMRRFYR*
Ga0137371_1080546213300012356Vadose Zone SoilPERVTIIRQNGYEIRDKNYRLLQNPKLPQENLPAAMQEMRRFYR*
Ga0137360_1179405213300012361Vadose Zone SoilPVNGYEIRDREYRLIPSPTVPRDVVRAALHEMRRFYR*
Ga0137361_1055510123300012362Vadose Zone SoilGYEIRDREYRLVANPTIPRDVVRAALHEMSRFYR*
Ga0137361_1081284023300012362Vadose Zone SoilGYEIRDENYRLVRHPTLPQESLRAALREMSRFYR*
Ga0137394_1004018343300012922Vadose Zone SoilASYEIRDRDYRLVTHSTLPREDLRAAQKEMSRFYR*
Ga0137394_1073335923300012922Vadose Zone SoilSYEIRDRDYRLVGHPTFPRDGLRAAQQEMSRFFR*
Ga0137394_1146974413300012922Vadose Zone SoilPDRITVVFPAGYEIRDRNYRLLQHPTLPRDGLRAALHEMSRFYR*
Ga0137407_1032302013300012930Vadose Zone SoilPASYEIRDRDYRLVAHPTFPHDGLRAAQQEMSRFFR*
Ga0137410_1015943123300012944Vadose Zone SoilYPASYEIRDRDYRMVVHPTFPRDGPRAAQQEMSRFYR*
Ga0137410_1022191513300012944Vadose Zone SoilPERVTIVYPAGYEIRDGDYRRVRKPTIPREVARAALREMSRFYR*
Ga0137410_1084198523300012944Vadose Zone SoilAGYEIRDRDYRLVRNPTLPRDGLRAAMQEMSRFYR*
Ga0126375_1195575013300012948Tropical Forest SoilDRVTVVFPSGYEIRDRNYRLVPKPTLSRDELTAAMQEMGRFYR*
Ga0134076_1034260823300012976Grasslands SoilIEPERVTIVYSAGYEIRDGDYRLVRNPTIPRDVVRAALHEISRFYR*
Ga0157365_1018272023300013001Fungus GardenLEPDQVTIVYPASYEIRDRSYRLVRNPSLPREALREAQKEMSRFYR*
Ga0180069_113390513300014882SoilASYEVRDRNYRLVPNPTLPRDSLRAAMHEMRRFYR*
Ga0180086_119091223300014883SoilPDRVTVVLPGGYEIRDRNYRLVSNPALPRDGLRAALHEMSRFYR*
Ga0132256_10308028423300015372Arabidopsis RhizospherePSSYEIRDRNYRLVPKPALPRDVMQAALREMSRFYR*
Ga0132257_10003627313300015373Arabidopsis RhizospherePDRVTVVLPSSYEIRDRNYRLVPKPTLPRDVVQAALKEMSRFYR*
Ga0184618_1005888223300018071Groundwater SedimentERVTLLSPASYEIRDLDYRLVAHPTFPHDGLRAAQQEMSRFFR
Ga0184633_1019012023300018077Groundwater SedimentRPNGYEIRDRGYRLVQNPQLPNASLRAALQEMRRFYRQ
Ga0184627_1010604823300018079Groundwater SedimentTVVYPAGYEIRDQNYRLVRNPKLSRDVVRAALHEMSRFYR
Ga0193754_102079013300019872SoilLIEPERVTIVYSASYEIRDRDYRLVTHPILPREDLRAAQKEMSRFYR
Ga0193707_107512713300019881SoilIVYPASYEIRDRDYRLVAHPTFPRDGLRAAQQEMSRFYR
Ga0193713_100646413300019882SoilEFALLQPERVTIVYPASYEIRDRDYRLVAHPTFPHDGLRAAQQEMSRFFR
Ga0193711_100500823300019997SoilRVTIVYSASYEIRDRDYRLVTHPILPREDLRAAQKEMSRFYR
Ga0206227_111627823300021063Deep Subsurface SedimentVAIVYPASYEIRDQNYRLVPNPTLPRDGLRAGLHEMRRLYR
Ga0224452_105124423300022534Groundwater SedimentYPASYEIRDRDYRLVAHPTFPHDGLRAAQQEMSRFFR
Ga0137417_130592223300024330Vadose Zone SoilVTVVYPASYEIRDREYRLVAHPTFPRAGLGAAQQEMSRFFR
Ga0209642_1012677813300025167SoilIEQERVTIVRPNGYEIRDRNYRLVPKPQLPNAGLRAALAEMRRFYR
Ga0210094_101965513300025549Natural And Restored WetlandsPERVTIVYPASYEIRDRDYRLVAHPTPPRDSLRAAQREMSRFFR
Ga0209761_130440623300026313Grasslands SoilVIIVHPAGYEIRDREYRLVANPTIPREVVRAALHEMSRFYR
Ga0209686_119153823300026315SoilDYALIEPERVIIVHPAGYEIRDREYRLVANPTIPREVVRAALHEMSRFYR
Ga0209154_130834223300026317SoilVTIVYPAGYEIRDGDYRLVRNPTIPRDVVRAALHEMSRFYR
Ga0209471_101333113300026318SoilVVLAGGYEIRDENYRLVRHPTLPQESLRAALREMSRFYR
Ga0209056_1059327223300026538SoilDFALIEPDRVTIAYPADYEIRDRDYRLVQNPRIPHDGLRAALREMRRFYR
Ga0208997_102802613300027181Forest SoilVTIVYPASYEIRDRDYRLVAHPTFPRDGLRAAQQEMSRFYR
Ga0209388_121468223300027655Vadose Zone SoilRVTIVYPAGYEIRDREYRLVANPTIPRDVVRAALHEMSRFYR
Ga0209180_1046029713300027846Vadose Zone SoilIVYPAGYEIRDRDYRLVGHPTIPREVVRAALHEMSRFYR
Ga0209283_1042255913300027875Vadose Zone SoilVYPAGYEIRDRDYRLVGHPTIPREVVRAALHEMSRFYR
Ga0209590_1030433613300027882Vadose Zone SoilIVYRAGIEIRDQNYRLVQNPTLPRDRLRAALQEMSRFYR
Ga0268265_1004707543300028380Switchgrass RhizosphereERVTIVYPASYEIRDRAYRLVAHPTLPREGLRGAQKEMSRFYR
Ga0268264_1185929223300028381Switchgrass RhizospherePASYEIRDRAYRLVAHPTLPREGLRGAQKEMSRFYR
Ga0137415_1082308523300028536Vadose Zone SoilEPDRITVVFPAGYEIRDRNYRLLQNPTLPRDGLRAALHEMSRFYR
Ga0307282_1025735013300028784SoilLIEPERVTIVYPASYEIRDRAYRLVAHPALPRDSLRAAQKEMNRFFR
Ga0307312_1000912063300028828SoilLEPERVTIVYPASYEIRDRDYRLVAHPTFPRDALRAAQQEMSRFYR
Ga0307312_1081050323300028828SoilVWRREGGYPTGYEIRDRDYRLVRNPTIPRDVVRAARHEKSPFYR
Ga0307499_1024605623300031184SoilYPSGYEIRDQNYRLVQNPQPSRDHLRAAMQEMRRFYR
Ga0307469_1019140723300031720Hardwood Forest SoilLEPERVTIVYPASYEIRDRDYRLVARPTLPRDGLRAAQQEMSRFYR
Ga0315297_1103984323300031873SedimentVAIVHSASYEIRDQNYRLVPDPTLPRDGLRAALHEMRR
Ga0307470_1087143323300032174Hardwood Forest SoilRVTIAYPAGYEIRDRDYRLVQNPRIPHEGLGAALREMRRFYR
Ga0307471_10029821313300032180Hardwood Forest SoilLIEPDRVTVVLPSSYEIRDRNYRLVPKPTLPRDVVQAALKEMSRFYR
Ga0307471_10152707813300032180Hardwood Forest SoilPSGYEIRDQNYRLVQNPQPSRDHLRAAMQEMRRFYR
Ga0307472_10161415913300032205Hardwood Forest SoilGAGYEVRDRDYRLVAHPTLFRDGLRAAQKEMSRFYR
Ga0315273_1066545113300032516SedimentIVRPNGYEIRDRNYRLVQNPQLPSAGLRAALKEMRRFYR
Ga0326730_101588233300033500Peat SoilFALVEPDQVTIVSPTSYEIRDRNYRLIPDPTLPRDRLRAAMHEMRRFYR
Ga0364934_0409962_1_1233300034178SedimentIVRPNGYEIRDRGYRLVQNPQLPNASLRAALQEMRRFYRQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.