NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100640

Metagenome / Metatranscriptome Family F100640

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100640
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 41 residues
Representative Sequence LLQELAAEVAGWPDAPSEAETAAMLRPVGRNFIPDRYR
Number of Associated Samples 95
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.02 %
% of genes from short scaffolds (< 2000 bps) 94.12 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (76.471 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(36.274 % of family members)
Environment Ontology (ENVO) Unclassified
(35.294 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.157 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.30%    β-sheet: 0.00%    Coil/Unstructured: 69.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF08245Mur_ligase_M 68.63
PF13599Pentapeptide_4 0.98



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A76.47 %
All OrganismsrootAll Organisms23.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352024|deeps__Contig_125841Not Available628Open in IMG/M
3300001356|JGI12269J14319_10142991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1044Open in IMG/M
3300004092|Ga0062389_101440225Not Available873Open in IMG/M
3300005186|Ga0066676_11033173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300005339|Ga0070660_100362649Not Available1194Open in IMG/M
3300005434|Ga0070709_10285715Not Available1200Open in IMG/M
3300005541|Ga0070733_10983687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia566Open in IMG/M
3300005546|Ga0070696_100223589Not Available1413Open in IMG/M
3300005564|Ga0070664_101685696Not Available601Open in IMG/M
3300005575|Ga0066702_10807320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia558Open in IMG/M
3300005602|Ga0070762_11249094Not Available515Open in IMG/M
3300006806|Ga0079220_11525109Not Available575Open in IMG/M
3300009029|Ga0066793_10593312Not Available631Open in IMG/M
3300009148|Ga0105243_10284193Not Available1492Open in IMG/M
3300009162|Ga0075423_10658586Not Available1104Open in IMG/M
3300009683|Ga0116224_10379283Not Available673Open in IMG/M
3300009698|Ga0116216_10077347Not Available2048Open in IMG/M
3300010152|Ga0126318_10571198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300010329|Ga0134111_10567531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300010376|Ga0126381_105038536Not Available506Open in IMG/M
3300010867|Ga0126347_1579842Not Available580Open in IMG/M
3300010880|Ga0126350_10700600Not Available664Open in IMG/M
3300010880|Ga0126350_11673472Not Available565Open in IMG/M
3300012507|Ga0157342_1012397Not Available897Open in IMG/M
3300012683|Ga0137398_10578846Not Available775Open in IMG/M
3300012955|Ga0164298_10326869Not Available961Open in IMG/M
3300012977|Ga0134087_10655378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia551Open in IMG/M
3300013296|Ga0157374_11119201Not Available808Open in IMG/M
3300016294|Ga0182041_12246471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300016387|Ga0182040_11564257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia561Open in IMG/M
3300016404|Ga0182037_10925592Not Available757Open in IMG/M
3300016422|Ga0182039_10156148Not Available1774Open in IMG/M
3300017821|Ga0187812_1161830Not Available719Open in IMG/M
3300017821|Ga0187812_1185032Not Available667Open in IMG/M
3300017823|Ga0187818_10192632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Candidatus Frankia datiscae890Open in IMG/M
3300017928|Ga0187806_1040048Not Available1406Open in IMG/M
3300017942|Ga0187808_10063457Not Available1578Open in IMG/M
3300017955|Ga0187817_10164427Not Available1412Open in IMG/M
3300017959|Ga0187779_11202786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia533Open in IMG/M
3300017975|Ga0187782_10251816Not Available1327Open in IMG/M
3300017975|Ga0187782_10806612Not Available726Open in IMG/M
3300017993|Ga0187823_10076581Not Available964Open in IMG/M
3300018044|Ga0187890_10113243Not Available1571Open in IMG/M
3300018062|Ga0187784_10965811Not Available678Open in IMG/M
3300018085|Ga0187772_10650873Not Available753Open in IMG/M
3300020579|Ga0210407_11423707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia513Open in IMG/M
3300021180|Ga0210396_10957279Not Available727Open in IMG/M
3300021181|Ga0210388_10786331Not Available825Open in IMG/M
3300021401|Ga0210393_10896425Not Available720Open in IMG/M
3300021479|Ga0210410_11520953Not Available562Open in IMG/M
3300024186|Ga0247688_1063233Not Available609Open in IMG/M
3300024288|Ga0179589_10132847Not Available1048Open in IMG/M
3300025910|Ga0207684_10962829Not Available715Open in IMG/M
3300025926|Ga0207659_11479657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia581Open in IMG/M
3300025939|Ga0207665_10408750Not Available1035Open in IMG/M
3300025945|Ga0207679_10282686Not Available1423Open in IMG/M
3300027696|Ga0208696_1094505Not Available998Open in IMG/M
3300027783|Ga0209448_10077468Not Available1116Open in IMG/M
3300027889|Ga0209380_10401985Not Available803Open in IMG/M
3300028773|Ga0302234_10302114Not Available686Open in IMG/M
3300028877|Ga0302235_10396994Not Available590Open in IMG/M
3300028879|Ga0302229_10025930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3155Open in IMG/M
3300028906|Ga0308309_10742383Not Available853Open in IMG/M
3300031199|Ga0307495_10238581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia518Open in IMG/M
3300031543|Ga0318516_10069748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia1947Open in IMG/M
3300031545|Ga0318541_10351711Not Available823Open in IMG/M
3300031546|Ga0318538_10332141Not Available820Open in IMG/M
3300031564|Ga0318573_10168592Not Available1153Open in IMG/M
3300031572|Ga0318515_10243384Not Available965Open in IMG/M
3300031668|Ga0318542_10178813Not Available1064Open in IMG/M
3300031680|Ga0318574_10104149Not Available1576Open in IMG/M
3300031681|Ga0318572_10120491Not Available1497Open in IMG/M
3300031682|Ga0318560_10339229Not Available811Open in IMG/M
3300031713|Ga0318496_10040026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2401Open in IMG/M
3300031748|Ga0318492_10066212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1721Open in IMG/M
3300031748|Ga0318492_10270661Not Available880Open in IMG/M
3300031764|Ga0318535_10024955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia2343Open in IMG/M
3300031778|Ga0318498_10333816Not Available678Open in IMG/M
3300031781|Ga0318547_10664696Not Available647Open in IMG/M
3300031797|Ga0318550_10132785Not Available1190Open in IMG/M
3300031894|Ga0318522_10206754Not Available743Open in IMG/M
3300031941|Ga0310912_10805272Not Available725Open in IMG/M
3300031981|Ga0318531_10179078Not Available953Open in IMG/M
3300032009|Ga0318563_10258821Not Available940Open in IMG/M
3300032009|Ga0318563_10270493Not Available918Open in IMG/M
3300032035|Ga0310911_10898909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia511Open in IMG/M
3300032035|Ga0310911_10932377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300032060|Ga0318505_10596060Not Available519Open in IMG/M
3300032064|Ga0318510_10234091Not Available751Open in IMG/M
3300032067|Ga0318524_10674111Not Available545Open in IMG/M
3300032068|Ga0318553_10410534Not Available709Open in IMG/M
3300032076|Ga0306924_10048396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4684Open in IMG/M
3300032090|Ga0318518_10394521Not Available710Open in IMG/M
3300032180|Ga0307471_102694636Not Available630Open in IMG/M
3300032805|Ga0335078_12059920Not Available608Open in IMG/M
3300032829|Ga0335070_10306819Not Available1537Open in IMG/M
3300033134|Ga0335073_11852748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia560Open in IMG/M
3300033158|Ga0335077_11280901Not Available713Open in IMG/M
3300033289|Ga0310914_11391079Not Available604Open in IMG/M
3300033289|Ga0310914_11896589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300033290|Ga0318519_10376046Not Available843Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil36.27%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment6.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.90%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.90%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.92%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.94%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.94%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.98%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.98%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.98%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.98%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300024186Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deeps_022784102199352024SoilSGLLQELAAEVAGWPDAPSQAETAAMLEPVGRNFIPDRYR
JGI12269J14319_1014299123300001356Peatlands SoilLLQELAAEVAGWPDAPSAADAAAMLRPAGNEPGNEPGNEPGNEQGENFIPAGYR*
Ga0062389_10144022523300004092Bog Forest SoilRADRAGDRLLRELADEVASRPDAPTDADAAAMLAPVGEAFIPAGYR*
Ga0066676_1103317313300005186SoilRVGSGLLQDLAAEVAGWPDAPSEAEIAAMFRPVGRNFIPDRYR*
Ga0070660_10036264923300005339Corn RhizosphereAGLLQDLAAEVAGWPDAPSQAETAAMLEPVGRNFIPDRYR*
Ga0070709_1028571523300005434Corn, Switchgrass And Miscanthus RhizosphereSGLLQELAAEVASWPDAPSPAETAAMLEPVGRNFIPDRYR*
Ga0070733_1098368713300005541Surface SoilSLLQELAREVASWPDAPDEADAAAMLRPVGQNFIPAGYR*
Ga0070696_10022358913300005546Corn, Switchgrass And Miscanthus RhizosphereGSSLLQELAAEVVGWPDAPSEAETAAMLRPVGRNFIPDRYR*
Ga0070664_10168569613300005564Corn RhizosphereLAGLAAEVAGWPDAPSEAETEAMLRPVSRNFIPNGYR*
Ga0066702_1080732023300005575SoilLLQELAAEVASWPDAPSEAEIAAMLRPVGRNFIPDRYR*
Ga0070762_1124909413300005602SoilSGHALLAELALEVAGWPDAPSAADATAMLAPVGESFIPAGYR*
Ga0079220_1152510913300006806Agricultural SoilRADTALLQELAAEVAGWPDTPSEAEIGVMLRPVGRSFVPGRYR*
Ga0066793_1059331213300009029Prmafrost SoilLQELAVEVTGWPDAPSATDAAAMLTPVAANFIPAGYR*
Ga0105243_1028419313300009148Miscanthus RhizosphereDSGLLQELAAEVASWPDAPSPAETAAMLEPVGRNFIPDRYR*
Ga0075423_1065858623300009162Populus RhizosphereLRELAAEVASWPDAPSQAETAAMLGPVGRNFIPDRYR*
Ga0116224_1037928313300009683Peatlands SoilLAAEVAGWPDAPSAADAAAMLRPAGNEPGNEPGNEPGNEQGENFIPAGYR*
Ga0116216_1007734743300009698Peatlands SoilRHDRVRPGLLQELAAEVAGWPDAPSDADAAAMLQPVGPNFIPARYR*
Ga0126318_1057119813300010152SoilQELAAEVASWPDAPSPAETAAMLEPAGRNFIPDRYR*
Ga0134111_1056753113300010329Grasslands SoilRADSGLLQELAADVAGWPDAPSQAETAAMLEPVGRNFIPDRYR*
Ga0126381_10503853623300010376Tropical Forest SoilELAAEVAAWPDAPSEAEIAAMLRPVGRNFVPDRYR*
Ga0126347_157984223300010867Boreal Forest SoilGDGLLATLAPEVASWPDAPTPAEVGAMLRPVSRNFIPNEYADEPA*
Ga0126361_1085141923300010876Boreal Forest SoilRDDRAGTALLQELAIEVAGWPDAPSAADADAMLKPVATNFIPAGYR*
Ga0126350_1070060013300010880Boreal Forest SoilLQELALEVAGWPDAPSAADADAMLKPVAANFIPAGYR*
Ga0126350_1167347213300010880Boreal Forest SoilDRLSDALLTELAGEVTSWPDAPSAADASAMLTPVSENFIPAGYR*
Ga0157342_101239713300012507Arabidopsis RhizosphereTDSGLLQELAAEVASWPDAPSEAETAAMLEPVGRNFIPDRYR*
Ga0137398_1057884613300012683Vadose Zone SoilLLQELAAEVAGWPDAPSEAETAAMLRPVGRNFIPDRYR*
Ga0164298_1032686923300012955SoilDRAGSGLLQELAAEVASWPDAPSPAETAAMLEPVGRHFIPDRSR*
Ga0134087_1065537823300012977Grasslands SoilTDSGLLQELAAEVAGWPDAPSQAETAAMLEPVGRNLIPDRYR*
Ga0157374_1111920113300013296Miscanthus RhizosphereRAESGLLQELAAEVASWPDAPSPAETAAMLEPVGRNFIPDRYR*
Ga0182041_1224647113300016294SoilELAAEVAGWPDAPSEAEIGAMLKPVGRSFVPPGYR
Ga0182040_1156425713300016387SoilELAAEVASWPDAPSETETAAMLRPVGRNFIPPGYR
Ga0182037_1092559213300016404SoilQVASWPDAPSAADAAAMLAPTGNEQGANFIPAGYQ
Ga0182039_1015614833300016422SoilADRADCLLLQDLAAEVASWPDAPSAADAAAMLAPTGNEQGGNFIPAGYR
Ga0187812_116183023300017821Freshwater SedimentVDRVGTGLLQELAAEVAGWPDAPSDADAAAMLRPVGRNFIPAGYQ
Ga0187812_118503223300017821Freshwater SedimentQELAAEVAGWPDAPSAADAAAMLRPAGGNFIPTGYR
Ga0187818_1019263233300017823Freshwater SedimentCRLLQELAAEVAGWPDAPSAADAAAMLRPAGNEQGGNFIPAGYR
Ga0187806_104004813300017928Freshwater SedimentGWPDAPSAADAAAMLRPAGNEPGNEPGNEPGNEQGENFIPAGYR
Ga0187808_1006345713300017942Freshwater SedimentDLAADVARWPDAPSAVDVAAMFRPVGENFVPAGYR
Ga0187817_1016442723300017955Freshwater SedimentRLLQELAAEVTGWPDAPSAADAAAMLRPAGNEPGNEPGNEPGNEQGENFIPAGYR
Ga0187779_1120278613300017959Tropical PeatlandLLQELAAEVAAWPDAPSAAEAAAMLRPVGRNFVPNEYR
Ga0187782_1025181623300017975Tropical PeatlandGQGLLAELAREVASWPDAPSEAEAAAMLRPVGDSFVPAGYR
Ga0187782_1080661213300017975Tropical PeatlandDLAAEVASWPDAPSAADVAAMLRPVGENFIPAGYR
Ga0187823_1007658113300017993Freshwater SedimentGLAAEVAGWPDAPSAAETEAMLRPVSRNFIPNGYADEPS
Ga0187890_1011324323300018044PeatlandGHPLLTELALEVSGWPDAPSAADAVAMLAPVAENFIPAGYR
Ga0187784_1096581123300018062Tropical PeatlandRELAREVAGWPDAPSAADAAAMLRPVGRNFVPAGYR
Ga0187772_1065087323300018085Tropical PeatlandEDRAGCGLLQALAAEVAGWPDAPSAAGIAAMLAPAGDERGETFIPAGFR
Ga0210407_1142370723300020579SoilGSALLQELAAEVAGWPDAPSEAEIAGMFRPVGRNFIPDRYR
Ga0210396_1095727923300021180SoilVGDGLLQELAAEVAGWPDAPSDADAAAMLRPVGQNFIPAGYR
Ga0210388_1078633123300021181SoilRVGGRLLQDLAAEVSGWPDAPTDADAAAMLRPVGDSFVPSGYRS
Ga0210393_1089642523300021401SoilAGDRLLQDLAAEVASWPDAPSDADAAAMLHPVGENFVPVRYR
Ga0210410_1152095313300021479SoilELAAEVASWPDAPSEAEIAAMLRPVGRNFIPPGYR
Ga0247688_106323313300024186SoilQELAAEVASWPDAPSPAETAAMLEPVGRNFIPDRYR
Ga0179589_1013284723300024288Vadose Zone SoilDRTDSGLLQDLAAEVAGWPDAPSQAETAAMLEPVGRNFIPDRYR
Ga0207684_1096282913300025910Corn, Switchgrass And Miscanthus RhizosphereSGLLQELAAEVAGWPDAPSEAEIAAMFRPVGRNFIPGRYR
Ga0207659_1147965713300025926Miscanthus RhizosphereGLLQELAAEVASWPDAPSPAETAAMLEPVGRNFIPDRYR
Ga0207665_1040875023300025939Corn, Switchgrass And Miscanthus RhizosphereKDSALLQELAAEVASWPDAPTEPDAMLRPVGRNFIPDAYR
Ga0207679_1028268613300025945Corn RhizosphereRDDRAGSGLLQELAAEVASWPDAPSPAETAAMLEPVGRNFIPDRYR
Ga0208696_109450523300027696Peatlands SoilQELAAEVAGWPDAPSAADAAAMLRPAGNEPGNEPGNEPGNEQGENFIPAGYR
Ga0209448_1007746813300027783Bog Forest SoilRLLQELAGEVASWPDAPTAADTAAMLRPAGNEPGNEPGNEQRESFIPAGYR
Ga0209380_1040198523300027889SoilELAAEVAGWPDAPSDADAAAMLRPVGQNFIPAGYR
Ga0302234_1030211423300028773PalsaPLLTELALEVDAWPDAPSAADAVAMLAPVGENFIPAGYR
Ga0302235_1039699413300028877PalsaLLTELALEVAGWPDAPSAADAVAMLAPVGGNFIPAGYR
Ga0302229_1002593053300028879PalsaRVDRAGDALLTELAGEVTGWPDAPSAADACAMLTPVSENFIPAGYR
Ga0308309_1074238323300028906SoilAFLQELAAEVAGWPDAPSEAEIAAMLRPVGRNFIPDRYR
Ga0307495_1023858113300031199SoilDSGLLQELAAEVAGWPDAPSQAETAAMLEPVGRNFIPDRYR
Ga0318516_1006974833300031543SoilGGGLLTELAAEVASWPDAPSGSEVAAMFRPVGGSFVPPGYR
Ga0318541_1035171123300031545SoilGLLTELAAEVASWPDAPSGSEVAAMFRPVGGSFVPPGYR
Ga0318538_1033214113300031546SoilAGGRLLQDLAAEVGSWPDAPSAADAAAMLAPVGETFIPAGYR
Ga0318573_1016859213300031564SoilTGGGLLTELAAEVASWPDAPSGSEVAAMFRPVGGSFVPPGYR
Ga0318515_1024338413300031572SoilLQELAAEVAGWPDAPTDADAAAMLAPAGNGQGENFIPAGYR
Ga0318542_1017881323300031668SoilVQELAAEVTSWPDAPSEAQAAAMLRPVGQNFIPNGYR
Ga0318574_1010414913300031680SoilTELAAEVASWPDAPSGSEVAAMFRPVGGSFVPPGYR
Ga0318572_1012049113300031681SoilGCHLLRDLAAEVAGWPDAPSAADAAAMLAPLGENFIPAGYR
Ga0318560_1033922913300031682SoilLLQDLAAEVASWPDAPSAADAAAMLAPTGYEQGRNFIPAGYR
Ga0318496_1004002633300031713SoilELAAEVAGWPDAPTDADAAAMLAPAGNGQGENFIPAGYR
Ga0318492_1006621213300031748SoilGGLLTELAAEVASWPDAPSGSEVAAMFRPVGGSFVPPGYR
Ga0318492_1027066113300031748SoilRSSRRADTGLLQELAAEVAGWPDAPSEAEIAAMLRPVGRNFIPDRYR
Ga0318535_1002495533300031764SoilDRTGCLLLQDLAVQVASWPDAPSAADAAAMLAPTGNEQGANFIPAGYQ
Ga0318498_1033381613300031778SoilDDRAGCRLLQNLAAEVAGWPDAPSAADAAAMLAPAGENFIPAGYR
Ga0318547_1066469613300031781SoilRLLQELAAEVAGWPDAPTDADAAAMLAPAGNGQGENFIPAGYR
Ga0318550_1013278513300031797SoilDRTGGGLLTELAAEVASWPDAPSGSEVAAMFRPVGGSFVPPGYR
Ga0318522_1020675413300031894SoilGRGLLTELAAEVAGWPDAPSDSETASMLRPVGANFIPLEYR
Ga0310912_1080527223300031941SoilGCLLLQDLAVQVASWPDAPSAADAAAMLAPTGNEPGNEQGANFIPAGYQ
Ga0318531_1017907813300031981SoilLQDLAVQVASWPDAPSAADAAAMLAPTGNEPGNEQGANFIPAGYQ
Ga0318563_1025882113300032009SoilGTTLLQELAAEVASWPDAPSETETAAMLRPVGRNFIPPGYR
Ga0318563_1027049323300032009SoilDRTGRGLLTELAAEVAGWPDAPSDSETASMLRPVGANFIPLEYR
Ga0310911_1089890923300032035SoilDRAGTTLLQELAAEVASWPDAPSETETAAMLRPVGRNFIPPGYR
Ga0310911_1093237713300032035SoilRAGCRLLRDLAAEVAGWPDAPSAADAAAMLAPIGENFIPAGYR
Ga0318505_1059606013300032060SoilLLTELAAEVAGWPDAPSDSETASMLRPVGANFIPLEYR
Ga0318510_1023409123300032064SoilLQELAAEVAGWPDAPSEAEIAAMLRPVGRNFIPDRYR
Ga0318524_1067411113300032067SoilTELAAEVASWPDAPSEEDIAAMLQPVGENFIPHGYR
Ga0318553_1041053423300032068SoilAHRLLQELAAEVAGWPDAPTDADAAAMLAPAGNGQGENFIPAGYR
Ga0306924_1004839663300032076SoilWPDAPSAADAAAMLAPTGNEPGNEQGANFIPAGYQ
Ga0318518_1039452123300032090SoilLRDLAAEVAGWPDAPSAADAAAMLAPLGENFIPAGYR
Ga0307471_10269463623300032180Hardwood Forest SoilRDDRTDSGLLQELAAEVASWPDAPSQAETAAMLEPVGRNFIPDRYR
Ga0335078_1205992023300032805SoilGSRLLQDLAAEVASWPDAPTDADAAAMLQRVGENFIPAGYR
Ga0335070_1030681913300032829SoilTALLRELAAEVASWPDTPSEAETEAMLRPVGRNFIPDRYR
Ga0335073_1185274813300033134SoilLLQELAAEVASWPDAPSPAETAAMLEPVGRNFIPDRYR
Ga0335077_1128090113300033158SoilLQELAAEVAGWPDAPSEAEIGAMLRPVGRSFVPPGYR
Ga0310914_1139107923300033289SoilADRTGGGLLTELAAEVASWPDAPSGSEVAAMFRPVGGSFVPPGYR
Ga0310914_1189658923300033289SoilDTALLQELAAEVAGWPDTPSEAEIGAMLRPVGRSFVPPGYR
Ga0318519_1037604623300033290SoilRVPRGPTLLQELAAEVAGWPDAPSEAEIGAMLKPVGRSFVPPGYR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.