| Basic Information | |
|---|---|
| Family ID | F100558 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VAATLALIAAFLFALAATLQQKGALNLPTISLAHPMSLVRL |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 50.00 % |
| % of genes near scaffold ends (potentially truncated) | 1.96 % |
| % of genes from short scaffolds (< 2000 bps) | 1.96 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (28.431 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.373 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.039 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 37.68% β-sheet: 0.00% Coil/Unstructured: 62.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF10011 | DUF2254 | 5.88 |
| PF03358 | FMN_red | 4.90 |
| PF04199 | Cyclase | 3.92 |
| PF06224 | HTH_42 | 2.94 |
| PF00282 | Pyridoxal_deC | 2.94 |
| PF11964 | SpoIIAA-like | 2.94 |
| PF00582 | Usp | 1.96 |
| PF00196 | GerE | 1.96 |
| PF00107 | ADH_zinc_N | 1.96 |
| PF04087 | DUF389 | 1.96 |
| PF00654 | Voltage_CLC | 1.96 |
| PF14023 | DUF4239 | 1.96 |
| PF04311 | DUF459 | 0.98 |
| PF08386 | Abhydrolase_4 | 0.98 |
| PF07690 | MFS_1 | 0.98 |
| PF01370 | Epimerase | 0.98 |
| PF03807 | F420_oxidored | 0.98 |
| PF03320 | FBPase_glpX | 0.98 |
| PF13635 | DUF4143 | 0.98 |
| PF00581 | Rhodanese | 0.98 |
| PF00682 | HMGL-like | 0.98 |
| PF04542 | Sigma70_r2 | 0.98 |
| PF13186 | SPASM | 0.98 |
| PF09860 | DUF2087 | 0.98 |
| PF13302 | Acetyltransf_3 | 0.98 |
| PF04191 | PEMT | 0.98 |
| PF09335 | SNARE_assoc | 0.98 |
| PF13522 | GATase_6 | 0.98 |
| PF03446 | NAD_binding_2 | 0.98 |
| PF00248 | Aldo_ket_red | 0.98 |
| PF01502 | PRA-CH | 0.98 |
| PF13230 | GATase_4 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 3.92 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 2.94 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 2.94 |
| COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 1.96 |
| COG1808 | Uncharacterized membrane protein AF0785, contains DUF389 domain | Function unknown [S] | 1.96 |
| COG0139 | Phosphoribosyl-AMP cyclohydrolase | Amino acid transport and metabolism [E] | 0.98 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.98 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.98 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.98 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.98 |
| COG1494 | Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase or related protein | Carbohydrate transport and metabolism [G] | 0.98 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.98 |
| COG2845 | Peptidoglycan O-acetyltransferase, SGNH hydrolase family | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300010040|Ga0126308_10701274 | Not Available | 696 | Open in IMG/M |
| 3300012988|Ga0164306_11610319 | Not Available | 560 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 28.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 9.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.80% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.96% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.96% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.98% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300022903 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L001-104B-6 | Environmental | Open in IMG/M |
| 3300022911 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027437 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G05K2-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027870 | Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1022148411 | 3300000559 | Soil | MASALALMAAFLFAVAATLQQKGALNLDGVSLANPMSLVRLV |
| JGI10214J12806_102240044 | 3300000891 | Soil | VAEILALVAAFFFALAATLQQKGALGMGEVSLGSPK |
| JGI10214J12806_110446592 | 3300000891 | Soil | VASLLALVAAFLFALAAALQQKGALNLPSISLRHPSSLARLV |
| JGI10214J12806_122979701 | 3300000891 | Soil | VAAALALIAAFCFALAATLQQRGALNLPTISLADPKSLIR |
| JGIcombinedJ13530_1014433251 | 3300001213 | Wetland | MADVLALTAAFLFALAAALQQKGALNLPTLSLAQPMSLVRLLGQTMW |
| Ga0070658_104954743 | 3300005327 | Corn Rhizosphere | MASILALAAAFLFALAAALQQKGALNLPELSLRDPASLVRLV |
| Ga0070690_1017059841 | 3300005330 | Switchgrass Rhizosphere | MASILALCAAFLFALAATLQQKGALNLPELSLRDPASLARLVGQTMWLM |
| Ga0070670_1022289852 | 3300005331 | Switchgrass Rhizosphere | MASILALCAAFLFALAATLQQKGALNLPELSLRDPASLARLVGQT |
| Ga0070682_1016628172 | 3300005337 | Corn Rhizosphere | VAATLALIAAFCFALAATLQQRGALNLPTISLADPKSLLRLA |
| Ga0070659_1020581111 | 3300005366 | Corn Rhizosphere | VAATLALIAAFLFALAAALQQKGALNLPTISLAHPMSLVRLA |
| Ga0066682_107871282 | 3300005450 | Soil | MAAALALMAAFLFAVAATLQQKGALNLDGVSLATPMSLVRLVGQRMW |
| Ga0070662_1006143853 | 3300005457 | Corn Rhizosphere | MASVLALIAAFLFAVAATLQQKGALNLPEISLRDPATLAR |
| Ga0070662_1018452822 | 3300005457 | Corn Rhizosphere | MASILALVAAFLFALAATLQQKGALNLSELSLRDPASLARLVGQTTWL |
| Ga0070699_1018292721 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MAATLALVAAFLFALAATLQQKGALNLPTISLAQPMSLVRL |
| Ga0070684_1000473017 | 3300005535 | Corn Rhizosphere | MAAALALSAAFLFALAATLQQKGALNLAGVSLARPMSLVRLLGQRWW |
| Ga0068852_1012655441 | 3300005616 | Corn Rhizosphere | MASILALAAAFLFALAAALQQKGALNLPELSLRDPASLVRLVGQ |
| Ga0066905_1021103261 | 3300005713 | Tropical Forest Soil | VASALALLAAFLFALAAALQQKGALGLPEISLRDP |
| Ga0066903_1055609631 | 3300005764 | Tropical Forest Soil | VPSTLALIAAFLFALAAALQQKGALGLPEVSLREPK |
| Ga0075289_10909231 | 3300005888 | Rice Paddy Soil | VPSILALMAAALFALAAALQQKGALNLPELSLKSPA |
| Ga0075432_105325982 | 3300006058 | Populus Rhizosphere | VASLLALFAAFLFAVAAALQQKGALNLPSLSLRHPSSLARLVGQT |
| Ga0075425_1012691791 | 3300006854 | Populus Rhizosphere | VASLLALFAAFLFAVAAALQQKGALNLPSISLRHP |
| Ga0075425_1019047741 | 3300006854 | Populus Rhizosphere | LDSRRVADVLALCAAFLFALAATLQQKGALGMGDV |
| Ga0075434_1017740652 | 3300006871 | Populus Rhizosphere | VASLLALVAAFLFALAAALQQKGALNLPSISLRHPSSLA |
| Ga0075429_1007430493 | 3300006880 | Populus Rhizosphere | MAAALALMAAFLFALAATLQQKGALNLAGVSLAHPMSLVRLVGQ |
| Ga0074063_137095602 | 3300006953 | Soil | VPYAFRVAATLALVAAFLFALAAALQQKGALNLPTIS |
| Ga0111539_110605651 | 3300009094 | Populus Rhizosphere | VPSVLALVAAILFALAATLQQKGALNLPEVSLRHP |
| Ga0111539_115518281 | 3300009094 | Populus Rhizosphere | VASVLALVAALLFALAATLQQKGALNLPEISLRHPASL |
| Ga0105245_111230952 | 3300009098 | Miscanthus Rhizosphere | VAATLALIAAFCFALAATLQQRGALNLPTISLAEPKSLLRLAG |
| Ga0114129_119462282 | 3300009147 | Populus Rhizosphere | VASLLALFAAFLFAVAAALQQKGALNLPSLSLRHPSSLARLVG |
| Ga0111538_135596462 | 3300009156 | Populus Rhizosphere | MASVLALMAAVLFALAAALQQKGALNLPTVSLRDPASL |
| Ga0126313_105602502 | 3300009840 | Serpentine Soil | LIAALCFALAATLQQRGSLNLPTISLADPTSLVRL |
| Ga0126308_107012741 | 3300010040 | Serpentine Soil | MAATLALMAAFLFALAATLQQKGALNLAGVSLAKPMSLVRL |
| Ga0126382_123068091 | 3300010047 | Tropical Forest Soil | VPSLLALVAAFLFALAATLQQRGALGMGEVSLRSP |
| Ga0126376_111941562 | 3300010359 | Tropical Forest Soil | MAATLALIAAFLFAVAATLQQKGALNLDGVSLGNPKS |
| Ga0126376_128560361 | 3300010359 | Tropical Forest Soil | VASALALIAAFMFALAAALQQKGAIGLPEISLRHPSSLARLGGQATW |
| Ga0134126_108937242 | 3300010396 | Terrestrial Soil | LDSRRVADVLALCAAFLFALAATLQQKGALGMGDVSLGSPASF |
| Ga0137374_103454133 | 3300012204 | Vadose Zone Soil | MASALALMAAFLFAVAATLQQKGALNLDGVSLAKPMSLVRLAGQRIWL |
| Ga0137369_109541251 | 3300012355 | Vadose Zone Soil | MASALALMAAFLFAVAATLQQKGALNLDGVSLAKPMSLVRLAGQRI |
| Ga0157309_103560871 | 3300012895 | Soil | MLALVAAFLFALAAALQQKGALNLPELTLKSPASLLRLVGQTMWL |
| Ga0157291_101666611 | 3300012902 | Soil | MAAALALVAAFLFALAATLQQKGALNLPSVSLSEPSSLLEL |
| Ga0157289_102652432 | 3300012903 | Soil | MAAALALMAAFLFALAATLQQKGALNLAGVSLAKPMSLVRLVG |
| Ga0157308_100440901 | 3300012910 | Soil | MAAALALMAAFLFALAATLHQKGALNLAGVSLAKPMSLVRLVGQR |
| Ga0157310_100395341 | 3300012916 | Soil | MAAALALMAAFLFALAATLQQKGALNLAGVSLAKPMSLVRLVGQRM |
| Ga0164241_111159351 | 3300012943 | Soil | VASVLALAAAALFALAATLQQKGALNLPELSLRDPASLARL |
| Ga0164309_101523471 | 3300012984 | Soil | VADLLALVAACLFALAATLQQKGALGMGEVSLGKPSS |
| Ga0164308_103729373 | 3300012985 | Soil | MAAALALVAALLFALAATLQQKGAMHLPKVSLAQPMSLIR |
| Ga0164308_115605431 | 3300012985 | Soil | MASVLALSAAFLFAVAATLQQKGALNLDGVSLASPMS |
| Ga0164306_116103192 | 3300012988 | Soil | MAATLALMAAFLFAVAATLQQKGALNLDGVSLASPMSLVRLV |
| Ga0164305_110764832 | 3300012989 | Soil | MASALALMAAFLFAVAATLQQKGALKLDGVSLAKPMSLVRLVG |
| Ga0157380_127042611 | 3300014326 | Switchgrass Rhizosphere | VAEILALVAAFFFALAATLQQKGALGMGEVSLGSPKS |
| Ga0157377_100245671 | 3300014745 | Miscanthus Rhizosphere | MASILALAAAFLFALAAALQQKGALNLPELSLRDPASLVRLVGQRM |
| Ga0157376_101231371 | 3300014969 | Miscanthus Rhizosphere | MAATLALVAAFLFALAAALQQKGALNLPTISLAQPMSLVR |
| Ga0132258_108457675 | 3300015371 | Arabidopsis Rhizosphere | VASLLALVAASLFALAAALQQKGALNLPSISLRHPSSLARLAG |
| Ga0132256_1016205582 | 3300015372 | Arabidopsis Rhizosphere | MASILALCAAFLFALAATLQQKGALTPPELSLRDPASLARLVGQTMW |
| Ga0163161_100967665 | 3300017792 | Switchgrass Rhizosphere | MAAALALVAAFLFALAATLQQKGALNLPSVSLAEPSSLL |
| Ga0190266_111919602 | 3300017965 | Soil | VAATLALIAAFLFALAATLQQKGALNLPTISLAHPMSLVRL |
| Ga0184621_101128933 | 3300018054 | Groundwater Sediment | MAAALALIAAFLFALAAVLQQKGSLNRPTISVAHAMSLVRIL |
| Ga0184611_11913251 | 3300018067 | Groundwater Sediment | MAAALALMAAFLFAVAATLQQKGALNLDGVSLASPMSLVRLVGQR |
| Ga0184640_101741001 | 3300018074 | Groundwater Sediment | VAASLALVAAFLFALAAALQQKGALNLPTISLADPM |
| Ga0190274_123557932 | 3300018476 | Soil | VAATLALVAAFCFALAATLQQKGALNLPPISLKPASLVKLL |
| Ga0190271_101044304 | 3300018481 | Soil | VASALALLAALLFALAAALQQKGALNLPQISLRDPASLVR |
| Ga0173479_100675291 | 3300019362 | Soil | MAAALALVAAFLFALAATLQQKGALNLPSVSLAEPSSLLKLIGQTM |
| Ga0247774_11176292 | 3300022903 | Plant Litter | VAAALALIAAFCFALAATLQQRGALNLPTISLADPKSLIRLVGNITWL |
| Ga0247783_12633701 | 3300022911 | Plant Litter | MAAALALFAAVLFALAATLQQKGAMNLPKVSLARPMSLVRL |
| Ga0247790_101607581 | 3300022915 | Soil | MASILALVAALLFALAATLQQKGALNLPELSLRSPASL |
| Ga0247789_10692941 | 3300023266 | Soil | VAATLALIAAFLFALAATLQQKGALNLPTISLAHPMSLVRLAG |
| Ga0207642_103534381 | 3300025899 | Miscanthus Rhizosphere | MASVLALFAAFLFALAAALQQKGALNLAGVSLAKPMSFGL |
| Ga0207646_114101582 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VAEILAIVAAFFFALAATLQQKGALGMGEVSLGSPKS |
| Ga0207683_107697441 | 3300026121 | Miscanthus Rhizosphere | MAATLALVAAFLFALAAALQQKGALNLPTISLAQPMSLVRL |
| Ga0207476_1014521 | 3300027437 | Soil | VAEILALVAAFFFALAATLQQKGALGMGEVSLGSP |
| Ga0209023_101542422 | 3300027870 | Freshwater And Sediment | VAEVLALIAAFLFALAAALQQKGALNLPTISLADPK |
| Ga0207428_106458832 | 3300027907 | Populus Rhizosphere | VAEILALVAAFFFALAATLQQKGALGMGEVSLGSPS |
| Ga0247828_104110822 | 3300028587 | Soil | VAATLALVAAFLFALAATLQQKGALELGGISLGSPASLLRLVRQTA |
| Ga0247822_113479261 | 3300028592 | Soil | VAATLALIAAFLFALAATLQQKGALELGGVGSASS |
| Ga0307291_10754811 | 3300028707 | Soil | MAAALALIAAFLFALAAVLQQKGSLNRPTISVAHAMSLVPIVGEK |
| Ga0307303_101780381 | 3300028713 | Soil | MAAALALSAAFLFALAATLQQKGALNLAGVSLASPMSLVRLV |
| Ga0307301_102459331 | 3300028719 | Soil | MAATLALFAAFLFALAATLQQKGALNLPTISLADPMSLVRLVG |
| Ga0307315_101014792 | 3300028721 | Soil | MAATLALFAAFLFALAATLQQKGALNLPTITLADPMSLVRLVGE |
| Ga0307315_101833971 | 3300028721 | Soil | MAAALALIAAFLFALAAVLQQKGSLNRPTISVAHAMSL |
| Ga0302262_102779342 | 3300028743 | Fen | VADVLALIAAFLFAVAATLQQKGALNLPKISLGDPK |
| Ga0307318_102061762 | 3300028744 | Soil | VAATLALVAALLFALAATLQQKGALNLPTISLADPMSLVRLVGEKTWL |
| Ga0307299_102151492 | 3300028793 | Soil | MAATLALIAAFLFALAAALQQKGALNLPTISLAHPMSLVRL |
| Ga0247825_104355712 | 3300028812 | Soil | VAASLALVAALCFALAATLQQKGALNLPTISLAQPASLLR |
| Ga0307302_101075804 | 3300028814 | Soil | MAAALALIAAFLFALAAALQQKGSLNLPTISLAHPMSLVRLV |
| Ga0307302_105699011 | 3300028814 | Soil | MAATLALFAAFLFALAATLQQKGALNLPTISLADPMSLVR |
| Ga0307296_106713301 | 3300028819 | Soil | MAAALALIAAFLFAVAATLQQKGALNLDGVSLASPMSLVRLVGQ |
| Ga0307314_101594053 | 3300028872 | Soil | MASVLALFAAFLFAVAAALQQKGALNLAGVSLAKPMSLVRLAGQ |
| Ga0307289_102925891 | 3300028875 | Soil | VAATLALVAAFLFALAATLQQKGALNLPTISLADPM |
| Ga0307286_100147483 | 3300028876 | Soil | MAATLALIAAFLFALAAALQQKGALNLPTVSLAHPMSLVRLVGQTTW |
| Ga0247827_107127682 | 3300028889 | Soil | MAAALALVAAFLFALAATLQQKGALNLPSVSLAEPSS |
| Ga0247826_105222442 | 3300030336 | Soil | MLFALAATLQQKGALNLPTISLAQPASLLRLVGQTMWL |
| Ga0247826_107607601 | 3300030336 | Soil | MASVLALVAAFLFAVAATLQQKGALNLPEISLRDPATLARLAGQT |
| Ga0310887_108447792 | 3300031547 | Soil | VASILALVAAFLFALAATLQQKGALNLSELSLRDPAS |
| Ga0310813_101212051 | 3300031716 | Soil | MASILALAAAFLFALAAALQQKGALNLPELSLRDPA |
| Ga0310907_102933622 | 3300031847 | Soil | VAATLALVAAFLFALAATLQQKGALNLPSVSLASPASL |
| Ga0310897_104873361 | 3300032003 | Soil | VAATLALIAAFLFALAATLQQKGALQLGGVGSASSL |
| Ga0315292_111015681 | 3300032143 | Sediment | VADVLALIAAFLFAVAATLQQKGALNLPKISLGDPKSLMRLVEQTWW |
| Ga0315283_101154943 | 3300032164 | Sediment | VAAALALIAAFLFAVAATLQQKGALNLPKISLADPKSLVRLVGQTWWLR |
| Ga0315283_109158692 | 3300032164 | Sediment | VADVLALIAAFLFAVAATLQQKGALNLPKISLGDP |
| Ga0315268_113618892 | 3300032173 | Sediment | VADVLALIAAFLFAVAATLQQKGALNLQKISLGDP |
| Ga0315273_123945971 | 3300032516 | Sediment | VAAALALIAAFLFALAATLQQKGALNLPTISLADPMSLVRLA |
| Ga0247829_115506921 | 3300033550 | Soil | VASLLALVAARAKSTAATLQQKGALNLPALSLRNPA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |