Basic Information | |
---|---|
Family ID | F100542 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 44 residues |
Representative Sequence | DYAFPKGTPLEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF |
Number of Associated Samples | 87 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 4.90 % |
% of genes near scaffold ends (potentially truncated) | 95.10 % |
% of genes from short scaffolds (< 2000 bps) | 92.16 % |
Associated GOLD sequencing projects | 81 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.588 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.823 % of family members) |
Environment Ontology (ENVO) | Unclassified (51.961 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 19.44% Coil/Unstructured: 80.56% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF05013 | FGase | 14.71 |
PF06725 | 3D | 7.84 |
PF00497 | SBP_bac_3 | 6.86 |
PF03372 | Exo_endo_phos | 5.88 |
PF11742 | DUF3302 | 3.92 |
PF05433 | Rick_17kDa_Anti | 3.92 |
PF00583 | Acetyltransf_1 | 2.94 |
PF00375 | SDF | 2.94 |
PF00939 | Na_sulph_symp | 2.94 |
PF01557 | FAA_hydrolase | 1.96 |
PF12447 | DUF3683 | 1.96 |
PF03330 | DPBB_1 | 1.96 |
PF00072 | Response_reg | 0.98 |
PF04552 | Sigma54_DBD | 0.98 |
PF03449 | GreA_GreB_N | 0.98 |
PF00892 | EamA | 0.98 |
PF00230 | MIP | 0.98 |
PF01551 | Peptidase_M23 | 0.98 |
PF05990 | DUF900 | 0.98 |
PF02530 | Porin_2 | 0.98 |
PF01070 | FMN_dh | 0.98 |
PF01266 | DAO | 0.98 |
PF01515 | PTA_PTB | 0.98 |
PF06826 | Asp-Al_Ex | 0.98 |
PF00561 | Abhydrolase_1 | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG3741 | N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 14.71 |
COG3931 | Predicted N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 14.71 |
COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 2.94 |
COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 2.94 |
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.98 |
COG0280 | Phosphotransacetylase (includes Pta, EutD and phosphobutyryltransferase) | Energy production and conversion [C] | 0.98 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.98 |
COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.98 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.98 |
COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 0.98 |
COG2985 | Uncharacterized membrane protein YbjL, putative transporter | General function prediction only [R] | 0.98 |
COG3637 | Opacity protein LomR and related surface antigens | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
COG4782 | Esterase/lipase superfamily enzyme | General function prediction only [R] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 70.59 % |
Unclassified | root | N/A | 29.41 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001213|JGIcombinedJ13530_106027454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 517 | Open in IMG/M |
3300004114|Ga0062593_101871341 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300004643|Ga0062591_100666757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 934 | Open in IMG/M |
3300005288|Ga0065714_10497576 | Not Available | 525 | Open in IMG/M |
3300005333|Ga0070677_10288734 | Not Available | 829 | Open in IMG/M |
3300005338|Ga0068868_102273856 | Not Available | 517 | Open in IMG/M |
3300005347|Ga0070668_100359718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1234 | Open in IMG/M |
3300005347|Ga0070668_100595546 | Not Available | 966 | Open in IMG/M |
3300005356|Ga0070674_101501303 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
3300005364|Ga0070673_100213513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1667 | Open in IMG/M |
3300005365|Ga0070688_101245491 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300005438|Ga0070701_10292509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 998 | Open in IMG/M |
3300005459|Ga0068867_101700502 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
3300005543|Ga0070672_101459273 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
3300005553|Ga0066695_10273934 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1066 | Open in IMG/M |
3300005564|Ga0070664_100356216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1332 | Open in IMG/M |
3300005564|Ga0070664_101506150 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300005574|Ga0066694_10149344 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300005719|Ga0068861_101305201 | Not Available | 706 | Open in IMG/M |
3300005829|Ga0074479_11121275 | Not Available | 525 | Open in IMG/M |
3300005834|Ga0068851_10159214 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1239 | Open in IMG/M |
3300005844|Ga0068862_100039517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4007 | Open in IMG/M |
3300005844|Ga0068862_100090987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2657 | Open in IMG/M |
3300006871|Ga0075434_100211386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1960 | Open in IMG/M |
3300006881|Ga0068865_100420539 | Not Available | 1099 | Open in IMG/M |
3300009091|Ga0102851_11526746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 745 | Open in IMG/M |
3300009177|Ga0105248_12829190 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
3300009179|Ga0115028_10430373 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
3300009527|Ga0114942_1323945 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300009553|Ga0105249_10665027 | Not Available | 1100 | Open in IMG/M |
3300010400|Ga0134122_10375710 | Not Available | 1247 | Open in IMG/M |
3300010403|Ga0134123_13455199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
3300011106|Ga0151489_1664128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 517 | Open in IMG/M |
3300011405|Ga0137340_1052416 | Not Available | 779 | Open in IMG/M |
3300011436|Ga0137458_1171070 | Not Available | 656 | Open in IMG/M |
3300012212|Ga0150985_102741838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 550 | Open in IMG/M |
3300012893|Ga0157284_10064387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
3300012896|Ga0157303_10207633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
3300012989|Ga0164305_11617294 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
3300013308|Ga0157375_10485103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1401 | Open in IMG/M |
3300013308|Ga0157375_11127604 | Not Available | 919 | Open in IMG/M |
3300014298|Ga0075341_1006219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio | 1361 | Open in IMG/M |
3300014326|Ga0157380_10418462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1277 | Open in IMG/M |
3300014326|Ga0157380_12545282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 578 | Open in IMG/M |
3300014968|Ga0157379_11309243 | Not Available | 700 | Open in IMG/M |
3300014968|Ga0157379_11740276 | Not Available | 611 | Open in IMG/M |
3300014969|Ga0157376_10274872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1584 | Open in IMG/M |
3300015374|Ga0132255_102567164 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300018476|Ga0190274_13053044 | Not Available | 562 | Open in IMG/M |
3300018476|Ga0190274_13161918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 554 | Open in IMG/M |
3300018476|Ga0190274_13467709 | Not Available | 532 | Open in IMG/M |
3300019362|Ga0173479_10338036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 702 | Open in IMG/M |
3300024055|Ga0247794_10203785 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300025321|Ga0207656_10195002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium ADurb.Bin100 | 976 | Open in IMG/M |
3300025321|Ga0207656_10495701 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300025893|Ga0207682_10393270 | Not Available | 655 | Open in IMG/M |
3300025907|Ga0207645_10733895 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
3300025919|Ga0207657_10247972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1420 | Open in IMG/M |
3300025919|Ga0207657_11363710 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
3300025934|Ga0207686_10206931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1408 | Open in IMG/M |
3300025940|Ga0207691_10199243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1743 | Open in IMG/M |
3300025972|Ga0207668_10478133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1068 | Open in IMG/M |
3300025972|Ga0207668_12163331 | Not Available | 501 | Open in IMG/M |
3300026035|Ga0207703_11359126 | Not Available | 683 | Open in IMG/M |
3300026061|Ga0208541_1000286 | All Organisms → cellular organisms → Bacteria | 2796 | Open in IMG/M |
3300026075|Ga0207708_10806690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 808 | Open in IMG/M |
3300026088|Ga0207641_10154741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2079 | Open in IMG/M |
3300026089|Ga0207648_10320313 | Not Available | 1393 | Open in IMG/M |
3300026095|Ga0207676_10137274 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2088 | Open in IMG/M |
3300026118|Ga0207675_101393308 | Not Available | 722 | Open in IMG/M |
3300026142|Ga0207698_10052382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3126 | Open in IMG/M |
3300027902|Ga0209048_10383713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 967 | Open in IMG/M |
3300027902|Ga0209048_10477263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis | 846 | Open in IMG/M |
3300028379|Ga0268266_10296991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1506 | Open in IMG/M |
3300028608|Ga0247819_10572465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
3300028741|Ga0302256_10079013 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300028809|Ga0247824_10634752 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
3300029984|Ga0311332_10869602 | Not Available | 720 | Open in IMG/M |
3300030002|Ga0311350_10630030 | Not Available | 963 | Open in IMG/M |
3300030010|Ga0302299_10363968 | Not Available | 743 | Open in IMG/M |
3300030114|Ga0311333_10502572 | Not Available | 993 | Open in IMG/M |
3300030294|Ga0311349_11299624 | Not Available | 677 | Open in IMG/M |
3300031170|Ga0307498_10475466 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300031226|Ga0307497_10626582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
3300031707|Ga0315291_10740621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 866 | Open in IMG/M |
3300031720|Ga0307469_10019633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 3635 | Open in IMG/M |
3300031720|Ga0307469_11334169 | Not Available | 682 | Open in IMG/M |
3300031740|Ga0307468_100738443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 829 | Open in IMG/M |
3300031918|Ga0311367_10671238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1054 | Open in IMG/M |
3300031918|Ga0311367_10957188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 859 | Open in IMG/M |
3300032143|Ga0315292_11057153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 672 | Open in IMG/M |
3300032164|Ga0315283_11722655 | Not Available | 633 | Open in IMG/M |
3300032180|Ga0307471_103648325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia glumae | 545 | Open in IMG/M |
3300032205|Ga0307472_100007106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 5333 | Open in IMG/M |
3300032275|Ga0315270_10322539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. URHB0020 | 973 | Open in IMG/M |
3300032516|Ga0315273_10910178 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300032516|Ga0315273_11942448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 701 | Open in IMG/M |
3300032829|Ga0335070_11851490 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300032897|Ga0335071_11099908 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300033414|Ga0316619_12241366 | Not Available | 500 | Open in IMG/M |
3300033419|Ga0316601_101675403 | Not Available | 641 | Open in IMG/M |
3300033493|Ga0316631_10438745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 544 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.82% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.86% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.88% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.90% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.94% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.96% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.96% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.96% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.98% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.98% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.98% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.98% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.98% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011405 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 | Environmental | Open in IMG/M |
3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014298 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026061 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
3300028741 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4 | Environmental | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033493 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_A | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ13530_1060274542 | 3300001213 | Wetland | KGSLLEGLVATFRYSWLREDGAAQTGTQLRAYLNYAVRF* |
Ga0062593_1018713411 | 3300004114 | Soil | PNRSETDVRVDYAIGKGTPLEGLVATLRYSWLHQEGSPQTAPQLRAYINYAVRF* |
Ga0062591_1006667572 | 3300004643 | Soil | DRQETDLRADYAFAKGTPLAGLVGTLRGGWLHQDGSPTAFQLRIYVNYVVPF* |
Ga0065714_104975761 | 3300005288 | Miscanthus Rhizosphere | RSETDVRVDYAIGKGTPLEGLVATLRYSWLHQEGSPQTAPQLRAYINYAVRF* |
Ga0070677_102887341 | 3300005333 | Miscanthus Rhizosphere | SNGAPLPNHNETDVRGDYAFAKGTLLEGLVATFRYSWLKQDGAAQTQTDLRAILNYGVRF |
Ga0068868_1022738561 | 3300005338 | Miscanthus Rhizosphere | NHNETDVRGDYAFAKGTLLEGLVATFRYSWLKQDGAAQTQTDLRAILNYGVRF* |
Ga0070668_1003597181 | 3300005347 | Switchgrass Rhizosphere | DYAIGKGTPLEGLVATLRYSWLHQEGSPQTAPQLRAYINYAVRF* |
Ga0070668_1005955462 | 3300005347 | Switchgrass Rhizosphere | VRGDYAFAKGTWAEGLVATFRYSWLHQDGSPQTQTDLRAILNYVVRF* |
Ga0070674_1015013031 | 3300005356 | Miscanthus Rhizosphere | AFPKGTPLEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF* |
Ga0070673_1002135131 | 3300005364 | Switchgrass Rhizosphere | PKGTALEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF* |
Ga0070688_1012454911 | 3300005365 | Switchgrass Rhizosphere | FPKGTALEGLVATARYAWLHQGGSPQTAPQLRLYINYVARF* |
Ga0070701_102925091 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | ADYAFAKDSALSGLVATLRGGWLHQDGSPTAFQLRIYVNYVVPS* |
Ga0068867_1017005022 | 3300005459 | Miscanthus Rhizosphere | FAKGTMLEGLVATLRYSWLHQDGSPQTAPQLRAYINYDVRF* |
Ga0070672_1014592731 | 3300005543 | Miscanthus Rhizosphere | LEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF* |
Ga0066695_102739341 | 3300005553 | Soil | ARRLVATFRYAWTHQHRAPQNGNQLRAYLNYLVRF* |
Ga0070664_1003562161 | 3300005564 | Corn Rhizosphere | PLEGLVATLRYSWLHQEGSPQTAPQLRAYINYAVRF* |
Ga0070664_1015061501 | 3300005564 | Corn Rhizosphere | FAKDSAFKGLVATLRGAWLHQDGSPTAFQLRIILNYAVPF* |
Ga0066694_101493441 | 3300005574 | Soil | RRLVATFRYAWTHQDGAPQNRNQLRAYLNYVVRF* |
Ga0068861_1013052011 | 3300005719 | Switchgrass Rhizosphere | YAFPKGTPLEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF* |
Ga0074479_111212752 | 3300005829 | Sediment (Intertidal) | KGSLLEGLSATVRYSWLHQDGALQTGTQLRAYLNYGVRF* |
Ga0068851_101592141 | 3300005834 | Corn Rhizosphere | RVDYAIGKGTPLEGLVATLRYSWLHQEGSPQTAPQLRAYINYAVRF* |
Ga0068862_1000395177 | 3300005844 | Switchgrass Rhizosphere | ADYAFAKDSALSGLVATLRGGWLHQDGSPTAFQLRVYVNYSVPF* |
Ga0068862_1000909873 | 3300005844 | Switchgrass Rhizosphere | RADYAFAKGTWAEGFVATFRYSWLHQDGSPQTQTDLRAILNYVVRF* |
Ga0075434_1002113862 | 3300006871 | Populus Rhizosphere | VRADYALAKGTLLEGLVALRYSWLRQDGAAQTQTDFRAILNYLVRF* |
Ga0068865_1004205392 | 3300006881 | Miscanthus Rhizosphere | DLRADYAFAKGTWAEGFVATFRYSWLHQDGSPQTQTDLRAILNYVVRF* |
Ga0102851_115267463 | 3300009091 | Freshwater Wetlands | GKGTLLEGLVATFRYAWLHQDGSPQTHTQLRAILNYAVRF* |
Ga0105248_128291902 | 3300009177 | Switchgrass Rhizosphere | EGLVATLKYSWLHQDGSPQTATQLRAYINYDVRF* |
Ga0115028_104303731 | 3300009179 | Wetland | DYAFPKGTLFEGLTATVRYAWTHEDGAAQTGTQLRAILNYAVRF* |
Ga0114942_13239451 | 3300009527 | Groundwater | ILEGLVATLRYSWLHQDGSPQTATQLRAYINYAIRF* |
Ga0105249_106650272 | 3300009553 | Switchgrass Rhizosphere | RQETDLRADYAFAKGTPLAGLVGTLRGSWLHQDGSPTAFQFRVIVNYNIPF* |
Ga0134122_103757102 | 3300010400 | Terrestrial Soil | FAKGTWADGFVATFRYSWLHQDGSPQTQTDLRAILNYVVRF* |
Ga0134123_134551992 | 3300010403 | Terrestrial Soil | YAFPKGTMLQGLVATLRYSWLHQDGSPQTAPQLRAYVSYDVRF* |
Ga0151489_16641281 | 3300011106 | Soil | AFAKGSVLEGLVATIRYSWLQQDGAPQTGTQLRAYVNYAARF* |
Ga0137340_10524162 | 3300011405 | Soil | RFDFAFAKGTALEGLVATLRGSWLHQSGSPQTAPQLRAILNYAVRF* |
Ga0137458_11710701 | 3300011436 | Soil | TALEGLVATLRSSWLHQSGSPQTAPQMRAILNYAVRF* |
Ga0150985_1027418382 | 3300012212 | Avena Fatua Rhizosphere | WETDVRGDYAFAKGAWAEGFVATFRYSWLHQDGSPQIQTDLRAILNYNVHF* |
Ga0157284_100643871 | 3300012893 | Soil | DYAFPKGTPLEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF* |
Ga0157303_102076331 | 3300012896 | Soil | TNIRADYAFPKGTPLEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF* |
Ga0164305_116172941 | 3300012989 | Soil | EGLVATLRYSWLHQDGSPQTAPQLRAYVNYDLRF* |
Ga0157375_104851033 | 3300013308 | Miscanthus Rhizosphere | PKGTPLEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF* |
Ga0157375_111276042 | 3300013308 | Miscanthus Rhizosphere | RADYAFAKGTWAEGLVATFRYSWLHEQGALQTQTDLRAILNYVVRF* |
Ga0075341_10062192 | 3300014298 | Natural And Restored Wetlands | GNQDETDVRVDYAFPKSSLLEGLVATLRYAWTHQDGTLQNGHQLRAYLNYEVRF* |
Ga0157380_104184623 | 3300014326 | Switchgrass Rhizosphere | RADYAFAKGTPLAGLVGTLRGSWLHQDGSPTAFQLRVYVNYSVPF* |
Ga0157380_125452821 | 3300014326 | Switchgrass Rhizosphere | DYAFAKDSALNGLVATLRGAWLHQDGSPTAFQLRVVLNYAVPF* |
Ga0157379_113092431 | 3300014968 | Switchgrass Rhizosphere | LRADYAFAKGTWADGFVATFRYSWLHQDGSPQTQTDLRAILNYVVRF* |
Ga0157379_117402761 | 3300014968 | Switchgrass Rhizosphere | DHWETDVRADYAFAKGTWAEGFVATFRYSWLHQDGSPQIQTDLRAILNYNVHF* |
Ga0157376_102748723 | 3300014969 | Miscanthus Rhizosphere | LLEGLVATFRYSWLKQDGAAQTQTDLRAILNYGVRF* |
Ga0132255_1025671642 | 3300015374 | Arabidopsis Rhizosphere | GKGTLLEGLVATFRYSWLHQDGSPQIATQLRAYVNYEFRF* |
Ga0190274_130530442 | 3300018476 | Soil | RADYAFAKGNVLEGFVATFRYSWLHQDGSPQTQTDLRAILNYGIRF |
Ga0190274_131619182 | 3300018476 | Soil | DRKETDLRADYAFAKDSALSGLVATLRGGWLHQDGSPTAYQLRVILNYAVPL |
Ga0190274_134677091 | 3300018476 | Soil | ADYAFAKGTLFEGLVATFRYSWLHQDGAAQTQTDLRAILNYGVRF |
Ga0173479_103380361 | 3300019362 | Soil | TDLRADYAFAKGTPLAGLVGTLRGGWLHQDGSPTAFQLRIYVNYVVPF |
Ga0247794_102037851 | 3300024055 | Soil | RVDYAIGKGTPLEGLVATLRYSWLHQEGSPQTAPQLRAYINYAVRF |
Ga0207656_101950021 | 3300025321 | Corn Rhizosphere | TDVRVDYAIGKGTPLEGLVATLRYSWLHQEGSPQTAPQLRAYINYAVRF |
Ga0207656_104957012 | 3300025321 | Corn Rhizosphere | LRADYAFAKDSALKGLVATLRGAWLHQDGSPTAFQLRIILNYAVPF |
Ga0207682_103932701 | 3300025893 | Miscanthus Rhizosphere | DVRGDYAFAKGTLLEGLVATFRYSWLKQDGAAQTQTDLRAILNYGVRF |
Ga0207645_107338952 | 3300025907 | Miscanthus Rhizosphere | DYAFPKGTALEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF |
Ga0207657_102479722 | 3300025919 | Corn Rhizosphere | MLQGLVATLRYSWLHQDGSPQTAPQLRAYVNYDVRF |
Ga0207657_113637101 | 3300025919 | Corn Rhizosphere | YAFPKGTALEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF |
Ga0207686_102069312 | 3300025934 | Miscanthus Rhizosphere | WAEGFVATFRYSWLHQDGSPQTQTDLRAILNYVVRF |
Ga0207691_101992431 | 3300025940 | Miscanthus Rhizosphere | FAKGTMLEGLVATLKYSWLHQDGSPQTATQLRAYINYDVRF |
Ga0207668_104781332 | 3300025972 | Switchgrass Rhizosphere | DYAIGKGTPLEGLVATLRYSWLHQEGSPQTAPQLRAYINYAVRF |
Ga0207668_121633311 | 3300025972 | Switchgrass Rhizosphere | FAKGTLLEGLVATFRYSWLKQDGAAQTQTDLRAILNYGVRF |
Ga0207703_113591262 | 3300026035 | Switchgrass Rhizosphere | AKGTWADGFVATFRYSWLHQDGSPQTQTDLRAILNYVVRF |
Ga0208541_10002861 | 3300026061 | Natural And Restored Wetlands | MRVDYAFAKGTLFEGLVATFRYAWTHQDGTLQNGHQLRAYLNYEVRF |
Ga0207708_108066901 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | TVLEGLVATFRYAWTHDGGPQTGQQLRAYLNYAFRF |
Ga0207641_101547411 | 3300026088 | Switchgrass Rhizosphere | AKGTWAEGFVATFRYSWLHQDGSPQIQTDLRAILNYNVHF |
Ga0207648_103203131 | 3300026089 | Miscanthus Rhizosphere | SWAEGLVATLRYSWLHQDGSPQTQTDLRAILNYVVRF |
Ga0207676_101372741 | 3300026095 | Switchgrass Rhizosphere | GDYAFAKGTLLEGLVATFRYSWLKQDGAAQTQTDLRAILNYGVRF |
Ga0207675_1013933081 | 3300026118 | Switchgrass Rhizosphere | KGTWADGFVATFRYSWLHQDGSPQTQTDLRAILNYVVRF |
Ga0207698_100523826 | 3300026142 | Corn Rhizosphere | ADYAFAKGTPLAGLVGTLRGGWLHQDGSPTAFQLRIYVNYVVPF |
Ga0209048_103837131 | 3300027902 | Freshwater Lake Sediment | VRLDYAFAKGTPLAGLVATFRYAWAHQDGAPQRGNQLRAYLNYVVPF |
Ga0209048_104772631 | 3300027902 | Freshwater Lake Sediment | PLPNRNETDVRVDYAIGKGTFLEGLVATFRYSWLHQEGSPQTATQLRAYLNYAVRF |
Ga0268266_102969911 | 3300028379 | Switchgrass Rhizosphere | LEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF |
Ga0247819_105724651 | 3300028608 | Soil | EYAFAKGTVLEGLVATLRYSWLHQDGSPQTAPQLRAYVNYDVRF |
Ga0302256_100790131 | 3300028741 | Fen | ADYLFPKGHVLEGLSATIRYSWQVQDGSPQTATQLRAYLNYDVRF |
Ga0247824_106347522 | 3300028809 | Soil | LEGLVATLRYSWLHQDGSPQTAPQLRAYVNYDFRF |
Ga0311332_108696022 | 3300029984 | Fen | ADYAFGKGTMLEGLIATFRYSWLRQEGLPMNTQLRAIINYAVRF |
Ga0311350_106300302 | 3300030002 | Fen | DYAFGKGTMLEGLIATFRYSWLRQEGLPMNTQLRAIINYAVRF |
Ga0302299_103639681 | 3300030010 | Fen | DYLFPKGHVLEGLSATIRYSWQVQDGSPQTATQLRAYLNYDVRF |
Ga0311333_105025722 | 3300030114 | Fen | DQNETNVRADYAFGKGTMLEGLIATFRYSWLRQEGLPMNTQLRAIINYAVRF |
Ga0311349_112996242 | 3300030294 | Fen | AFGKGTMLEGLIATFRYSWLRQEGLPMNTQLRAIINYAVRF |
Ga0307498_104754662 | 3300031170 | Soil | RNETDIRFDYAFAKGTVLEGLIATLRASWLHQNGSPQTATDLRAYLNYVVRF |
Ga0307497_106265822 | 3300031226 | Soil | RADYAFAKGTMLEGLVATLRYSWLHQDGSLQTAPQLRAYVNYDVRF |
Ga0315291_107406212 | 3300031707 | Sediment | YAIGKGTFLEGLVATFRYSWLRQDGSPQTGTQLRAYLNYAVRF |
Ga0307469_100196331 | 3300031720 | Hardwood Forest Soil | ARGARLRNHNETDVRADYAFAKGTLLEGLVAALRYSWLRQDGAAQTQTDFRAILNYLVRF |
Ga0307469_113341691 | 3300031720 | Hardwood Forest Soil | LAGLVATFRYSWQQQDGSPHTATQMRAILNYAVAF |
Ga0307468_1007384431 | 3300031740 | Hardwood Forest Soil | ETDVRLDYAFAKGTVLEGLVATFRYAWTHDGGPQTGQQLRAYLNYAFRF |
Ga0311367_106712381 | 3300031918 | Fen | VRADYLFPKGHVLEGLSATIRYSWQVQDGSPQTATQLRAYLNYDVRF |
Ga0311367_109571881 | 3300031918 | Fen | VRADYAFGKGTMLEGLIATFRYSWLRQEGLPMNTQLRAIINYAVRF |
Ga0315292_110571531 | 3300032143 | Sediment | GTFLEGLVATFRYSWLRQDGSPQTGTQLRAYLNYAVRF |
Ga0315283_117226551 | 3300032164 | Sediment | YAVGKGTFLEGLVATFRYSWLRQDGSPQTGTQLRAYLNYAVRF |
Ga0307471_1036483251 | 3300032180 | Hardwood Forest Soil | VRADYAFAKRTLLEGLVAALRYSWLRQDGAAQTQTDFRAILNYLVRF |
Ga0307472_1000071062 | 3300032205 | Hardwood Forest Soil | VRADYAFAKRTLLEGLVAALRHSWLRQDGAAQTQTDFRAILNYLVRF |
Ga0315270_103225393 | 3300032275 | Sediment | TFLEGLVATFRYSWLRQDGSPQTGTQLRAYLNYAVRF |
Ga0315273_109101781 | 3300032516 | Sediment | RVDYAIGRGSFLEGLVATFRYSWLHQEGSPQTATQLRAYLNYAVRF |
Ga0315273_119424482 | 3300032516 | Sediment | VDYAIGKGTFLEGLVATFRYSWLRQDGSPQTGTQLRAYLNYAVRF |
Ga0335070_118514902 | 3300032829 | Soil | LHGLSATVRYSWLHQDGAPQTATQLRAYINYEVAFR |
Ga0335071_110999081 | 3300032897 | Soil | ADYAIPFPKDHILHGLSATVRYSWLHQDGAPQTATQLRAYMNYEVAFR |
Ga0316619_122413661 | 3300033414 | Soil | AVGKGSVLEGMVATVRYSWLRQDGAQQTAPQLRIYVNYPIRF |
Ga0316601_1016754032 | 3300033419 | Soil | VGKGSVLEGMVATVRYSWLRQDGSPQTAPQLRIHLNLPIRF |
Ga0316631_104387452 | 3300033493 | Soil | SLFEGLAATFRYSWLQQDGAPQTGTQLRAYVNYAVKF |
⦗Top⦘ |