NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F100507

Metagenome Family F100507

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100507
Family Type Metagenome
Number of Sequences 102
Average Sequence Length 46 residues
Representative Sequence MSHRTRLLVALVSTGLIGYIAVGSLLGRVLGDTSYGQLAIFNEVVR
Number of Associated Samples 96
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 34.31 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 93.14 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.020 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(11.765 % of family members)
Environment Ontology (ENVO) Unclassified
(31.373 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(25.490 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 54.05%    β-sheet: 0.00%    Coil/Unstructured: 45.95%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF01551Peptidase_M23 79.41
PF00072Response_reg 8.82
PF06745ATPase 3.92
PF07689KaiB 1.96
PF03652RuvX 0.98
PF02616SMC_ScpA 0.98
PF01663Phosphodiest 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0816YqgF/RuvX protein, pre-16S rRNA maturation RNase/Holliday junction resolvase/anti-termination factorTranslation, ribosomal structure and biogenesis [J] 0.98
COG1354Chromatin segregation and condensation protein Rec8/ScpA/Scc1, kleisin familyReplication, recombination and repair [L] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.02 %
UnclassifiedrootN/A0.98 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908008|FWIREl_GJ4R3DH01BJ4P1All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100381276All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300004114|Ga0062593_100405608All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1221Open in IMG/M
3300004282|Ga0066599_100096972All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1379Open in IMG/M
3300005218|Ga0068996_10134085All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300005337|Ga0070682_101550017All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium571Open in IMG/M
3300005341|Ga0070691_10573375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium662Open in IMG/M
3300005345|Ga0070692_10441184All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium831Open in IMG/M
3300005347|Ga0070668_102226493All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300005445|Ga0070708_100932605All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium815Open in IMG/M
3300005447|Ga0066689_11047821All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300005457|Ga0070662_100585056All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium938Open in IMG/M
3300005488|Ga0074213_132982All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium841Open in IMG/M
3300005536|Ga0070697_100571970All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium992Open in IMG/M
3300005549|Ga0070704_101549455All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300005577|Ga0068857_100035611All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4408Open in IMG/M
3300005844|Ga0068862_102072274All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300006904|Ga0075424_102450196All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300009012|Ga0066710_100149343All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3246Open in IMG/M
3300009037|Ga0105093_10873389All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300009078|Ga0105106_10557941All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium822Open in IMG/M
3300009082|Ga0105099_10314063All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium921Open in IMG/M
3300009082|Ga0105099_10342625All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium883Open in IMG/M
3300009100|Ga0075418_12289447All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300009101|Ga0105247_11199324All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300009153|Ga0105094_10956114All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300009157|Ga0105092_10898474All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300009162|Ga0075423_10139262All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2547Open in IMG/M
3300009167|Ga0113563_11347539All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium836Open in IMG/M
3300009170|Ga0105096_10726134All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300009179|Ga0115028_11309692All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300009506|Ga0118657_12816087All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300009870|Ga0131092_10569933All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium997Open in IMG/M
3300010373|Ga0134128_11159919All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium853Open in IMG/M
3300010397|Ga0134124_11339015All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium740Open in IMG/M
3300010400|Ga0134122_12455655All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300010403|Ga0134123_13001139All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300010412|Ga0136852_11373508All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium670Open in IMG/M
3300010412|Ga0136852_12312534All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300010430|Ga0118733_103189784All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium895Open in IMG/M
3300011112|Ga0114947_11541872All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300012096|Ga0137389_10392512All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1184Open in IMG/M
3300012205|Ga0137362_10586000All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium962Open in IMG/M
3300012355|Ga0137369_10166461All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1735Open in IMG/M
3300012362|Ga0137361_11037411All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium740Open in IMG/M
3300012685|Ga0137397_10598092All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium820Open in IMG/M
3300012927|Ga0137416_11932920All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300012971|Ga0126369_11551918All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium752Open in IMG/M
3300012976|Ga0134076_10206833All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium825Open in IMG/M
3300014323|Ga0075356_1065223All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium818Open in IMG/M
3300014326|Ga0157380_10227036All Organisms → cellular organisms → Bacteria → Proteobacteria1674Open in IMG/M
3300015201|Ga0173478_10261298All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium763Open in IMG/M
3300015256|Ga0180073_1018620All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1257Open in IMG/M
3300015258|Ga0180093_1052912All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium921Open in IMG/M
3300015372|Ga0132256_103083813All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300018053|Ga0184626_10005525All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Archangium → Archangium gephyra4792Open in IMG/M
3300018059|Ga0184615_10432963All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium717Open in IMG/M
3300018060|Ga0187765_10251440All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1041Open in IMG/M
3300018060|Ga0187765_10867338All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium608Open in IMG/M
3300018072|Ga0184635_10108919All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1098Open in IMG/M
3300018079|Ga0184627_10127272All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1348Open in IMG/M
3300018468|Ga0066662_11749542All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300018469|Ga0190270_12764152Not Available553Open in IMG/M
3300022213|Ga0224500_10222754All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium691Open in IMG/M
3300022214|Ga0224505_10403641All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
(restricted) 3300024519|Ga0255046_10315723All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium732Open in IMG/M
3300025558|Ga0210139_1110351All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300025580|Ga0210138_1047124All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium986Open in IMG/M
3300025907|Ga0207645_10170990All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1424Open in IMG/M
3300025917|Ga0207660_11170486All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300026535|Ga0256867_10162840All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium831Open in IMG/M
3300027900|Ga0209253_10027857All Organisms → cellular organisms → Bacteria4743Open in IMG/M
3300028380|Ga0268265_11923142All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300028770|Ga0302258_1158866All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300030838|Ga0311335_10480770All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium861Open in IMG/M
3300030943|Ga0311366_11681506All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
(restricted) 3300031150|Ga0255311_1060627All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium801Open in IMG/M
3300031834|Ga0315290_11551050All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300031908|Ga0310900_10819197All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium754Open in IMG/M
3300031913|Ga0310891_10299571All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300032003|Ga0310897_10019437All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales2155Open in IMG/M
3300032143|Ga0315292_10426030All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1115Open in IMG/M
3300032174|Ga0307470_11491822All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300032260|Ga0316192_11219865All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300032955|Ga0335076_10458260All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1159Open in IMG/M
3300033004|Ga0335084_11145552All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium779Open in IMG/M
3300033408|Ga0316605_10158040All Organisms → cellular organisms → Bacteria1853Open in IMG/M
3300033413|Ga0316603_10365299All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1295Open in IMG/M
3300033416|Ga0316622_100198199All Organisms → cellular organisms → Bacteria2138Open in IMG/M
3300033416|Ga0316622_101332441All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium839Open in IMG/M
3300033434|Ga0316613_10736109All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium676Open in IMG/M
3300033480|Ga0316620_10623834All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1016Open in IMG/M
3300033482|Ga0316627_100868069All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium861Open in IMG/M
3300033487|Ga0316630_10921767All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium759Open in IMG/M
3300033489|Ga0299912_10351160All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1222Open in IMG/M
3300033513|Ga0316628_103860660All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300033557|Ga0316617_101946285All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300034052|Ga0373889_058586All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300034147|Ga0364925_0316729All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300034178|Ga0364934_0089665All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1152Open in IMG/M
3300034178|Ga0364934_0228905All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300034178|Ga0364934_0337019All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium571Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil11.76%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment6.86%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.90%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.92%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment3.92%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.94%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.94%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.94%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.96%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.96%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.96%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.96%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.96%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.98%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.98%
SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Sediment0.98%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.98%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.98%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.98%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.98%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.98%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.98%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.98%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.98%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.98%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.98%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908008Soil microbial communities from sample at FACE Site Metagenome WIR_Elev2EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300005218Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005488Sediment ecosystem from Lake Washington, Seattle, Washington, USA - Methane enrichmentEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009170Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010412Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300011112Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300014323Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015256Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10DEnvironmentalOpen in IMG/M
3300015258Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1DaEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300022213Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022214Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300025558Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025580Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028770Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_4EnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031150 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032260Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrowEnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033434Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_bEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033489Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300034052Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.2EngineeredOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
FWIREl_063750902124908008SoilMVALASTVVIGYVFVGSLLGRVLGDTSYGQLSIFNEVVRLVLEAYVEP
INPhiseqgaiiFebDRAFT_10038127613300000364SoilMSHRSRLLIALASTCLIGYIAVGALLGRALGDTSFGQLAIFNE
Ga0062593_10040560813300004114SoilMSPRVRLMVAFVSTGLIGYIALGSVLGRVRGDSTYGQLAVFNEVVRIVLD
Ga0066599_10009697223300004282FreshwaterMSPRARLLIAIVSTALVGYFLAGALLGRVVGDSSYAQLAVFNEVVGLID
Ga0068996_1013408513300005218Natural And Restored WetlandsMSHRARLVIALVSTGLIGYIAVGSLLGRALGDTSYGQLAIFNE
Ga0070682_10155001713300005337Corn RhizosphereMSPRGRLVVALVSTLLVAYVAVGSLLGRVFGDTTYGQLAVFNEVVRLV
Ga0070691_1057337513300005341Corn, Switchgrass And Miscanthus RhizosphereMSHRSRLLIALASTCLIGYIAVGALLGRALGDTSFGQLAIFNEVVRLV
Ga0070692_1044118413300005345Corn, Switchgrass And Miscanthus RhizosphereMSPRVRLLVAFISTGLIGYIAVGSLLGRVLGDSTYAQLSIFNEVVRLVIDG
Ga0070668_10222649313300005347Switchgrass RhizosphereMSPRGRLVVALVSTLLVAYVAVGSLLGRVFGDTTYGQLAVFNEVV
Ga0070708_10093260513300005445Corn, Switchgrass And Miscanthus RhizosphereMSPRTRLLVALASTLLIGYIAVGSLLGRVLGDTTYGQLSVFNEVVRLVLEAYV
Ga0066689_1104782123300005447SoilMSPRTRLLIALTSTVLIGYIAVGSLLGRVFGDTTYGQLSVFNEVVRLVLDAY
Ga0070662_10058505613300005457Corn RhizosphereMSPRVRLLVAFISTGLIGYIAVGSLLGRVLGDSTYAQLSIFNEVVRLVIDGYVD
Ga0074213_13298213300005488SedimentMSARLRLLIAVVSTTLVAYTVLGALPGRVAGDTTYGQLAVF
Ga0070697_10057197013300005536Corn, Switchgrass And Miscanthus RhizosphereMSPRTRLLVALASTLLIGYIAVGSLLGRVLGDTTYGQLSVFNEVVRLVLEAY
Ga0070704_10154945513300005549Corn, Switchgrass And Miscanthus RhizosphereMSPRTRLLIALTSTVLIGYIAVGSLLGRVLGDTTYGQLSVFNEVVR
Ga0068857_10003561143300005577Corn RhizosphereMVAFVSTGLIGYIALGSVLGRVRGDSTYGQLAVFNEVVRIVLDAYV
Ga0068862_10207227423300005844Switchgrass RhizosphereMVAFISTGLIGYIALGSVLGRVRGDSTYGQLAVFNE
Ga0075424_10245019623300006904Populus RhizosphereMSPRSRLLVALASTALIGYVALGSLLGRVLGDTSYGQLAIF
Ga0066710_10014934313300009012Grasslands SoilMRPRTRLLIALASTLLIGYIAVGSLLGRVFGDTTYGQLSVFNEVVRLVLEAY
Ga0105093_1087338913300009037Freshwater SedimentMSHRARLLVALVSTGLIGYVAVGSLLGRVLGDTSYGQ
Ga0105106_1055794113300009078Freshwater SedimentMSHRTRLVVALVSTGLIGYIAVGALLGRVLGDTSYGQIAIFNEVVR
Ga0105099_1031406323300009082Freshwater SedimentMSHRARLLVALVSTGLIGYVAVGSLLGRVLGDTSYGQLAIFNEVV
Ga0105099_1034262523300009082Freshwater SedimentMSHRTRLLVALVSTGLIGYIAVGSFLGRVLGDTSYGQLAIFNEVVR
Ga0075418_1228944723300009100Populus RhizosphereMSPRGRLFVALVSTLLVGYIAIGSLLGRVLGDSTYGHLA
Ga0105247_1119932423300009101Switchgrass RhizosphereMSPRVRLVVALTSTLLIGYIALGSLLGRVFGDSTYTQLTIFNEVVRLVIDAYVDRVE
Ga0105094_1095611423300009153Freshwater SedimentMSHRTRLVLALVSTGLIGYIAVGSLLARVLGDTSYGQLAIFNEVV
Ga0105092_1089847423300009157Freshwater SedimentMSHRTRLVLALVSTGLIGYIAVGSLLARVLGDTSYGQLAIFNEVVRLVIDSYV
Ga0075423_1013926213300009162Populus RhizosphereMVAFVSTGLIGYIALGSVLGRVRGDSTYGQLAVFNEVVR
Ga0113563_1134753923300009167Freshwater WetlandsMSHRTRLVVALVSTGLIGYIAVGSLLGRVLGDTSY
Ga0105096_1072613423300009170Freshwater SedimentMSHRARLLVALVSTGLIGYVAVGSLLGRVLGDTSYGQLAIFNEVVRLVL
Ga0115028_1130969223300009179WetlandMSHRARLLIALVSTGLIGYVAVGSLLGRVLGDTSYGQLAIFNEVVRLVLDAYVE
Ga0118657_1281608723300009506Mangrove SedimentMSPRSRLAVAFVSTGVIFYIAVGSVLGRVMGDTTYTQLAVFNEVI
Ga0131092_1056993323300009870Activated SludgeMSHRTRLVVALASTLVIGYVFVGSLLGRVLGDTSYG
Ga0134128_1115991913300010373Terrestrial SoilMSPRTRLLIALTSTVLIGYIAVGSLLGRVLGDTTYGQL
Ga0134124_1133901523300010397Terrestrial SoilMSPRTRLLVALASTLIIGYIAVGSLLGRVLGDTTYGQLSVFNEVVRLVLEAYVE
Ga0134122_1245565523300010400Terrestrial SoilMSPRTRLFVAMTSTCLIAYIAMGTLLGRVFGDTTYG
Ga0134123_1300113913300010403Terrestrial SoilMSPRLRLSIALVSTGLIFYIALGSYLGRVFGDTTYGQLALFN
Ga0136852_1137350813300010412Mangrove SedimentMSSRTRLLVALVSTGLIGYVAVGSLLARAFGDTSYGQ
Ga0136852_1231253413300010412Mangrove SedimentMSHRARLVVALVSTGLIGYVAVGSLLGRVLGDTSYGQLAIFN
Ga0118733_10318978413300010430Marine SedimentMSPRVRLLVALASTGLIGYVAVGSLLARALGDTGYGQLAIFNEVVRLVLDAYV
Ga0114947_1154187223300011112Deep SubsurfaceMSPRARLLVALASTGLISYVAVGSLLTRVLGDTSYGQLSIFNEVI
Ga0137389_1039251213300012096Vadose Zone SoilMSPRTRLLVALASTLLIGYIAVGSLLGRVLGDTTYGQLSVFNEVVRL
Ga0137362_1058600013300012205Vadose Zone SoilMTARSRLLVALASTALIGYVALGSFLGRVLGDTSYGQLAVF
Ga0137369_1016646113300012355Vadose Zone SoilMSPRSRLVLALVSTLLVAYVAVGSLLGRVFGDTTYGQLAV
Ga0137361_1103741113300012362Vadose Zone SoilMSPRGRLVIALISTLLVGYVAIGSLLGRVFGDTTYGQLAV
Ga0137397_1059809223300012685Vadose Zone SoilMMSPRGRLVLALVSTLLVAYVAVGSLLGRVFGDTTYGQLAVFNE
Ga0137416_1193292013300012927Vadose Zone SoilMTPRSRLLVALVSTALIGYVALGSLLGRVLGDTSYGQLAIFNEV
Ga0126369_1155191823300012971Tropical Forest SoilMSHRSRLLIALASTVLIGYIAVGALLGKAFGDTSYGQLAIFNEVVRLVLDAY
Ga0134076_1020683313300012976Grasslands SoilMSPRSRLLVALASTSLIGYVALGSLLGRVLGDTSYGQLAIFNEVVRLVVEAYVEP
Ga0075356_106522323300014323Natural And Restored WetlandsMSPRTRLAVAVASTALIGYIAIGSLLGRVLGDTSYG
Ga0157380_1022703613300014326Switchgrass RhizosphereMSPRGRLFIAILSTAFVGYVAVGSLLNRVLGDTSYTQLAIFNDVTRIV
Ga0173478_1026129813300015201SoilMSPRGRLFIAILSTAFVGYVAVGSLLNRVLGDTSYTQLAIFNDVTRI
Ga0180073_101862023300015256SoilMSHRTRLLVALVSTGLIGYIAVGSLLGRVLGDTSYGQLAIFN
Ga0180093_105291213300015258SoilMSHRSRLLVALASTVVIGYVFGGLLLGRVMGDTSYGQ
Ga0132256_10308381323300015372Arabidopsis RhizosphereMSPRSRLVVALLSTALIAYVALGSLLGRVFGDTSYGQLAIFNEVVRLVLGETLA
Ga0184626_1000552563300018053Groundwater SedimentMSPRTRLLVALISTVLIGYIAVGSLLGRVLGDTTYGQLSVFNEVVRLVLE
Ga0184615_1043296313300018059Groundwater SedimentMSHRSRLVVALVSTGLIGYVAVGSLLGKVLGNTSYGQLAIFNEVVRLMLDAYVEP
Ga0187765_1025144013300018060Tropical PeatlandMSPRTRLAVAIVSTAVIGYIAVGSLLGRVLGDTSYGQLAIFNEVVRLVL
Ga0187765_1086733813300018060Tropical PeatlandMSHRSRLLIALASTALIGYIAVGALLGKALGDTSYGQLAIFNEVVRLVLDAYVEP
Ga0184635_1010891923300018072Groundwater SedimentMMSPRGRLVVALVSTLLVAYVAVGSLLGRVFGDTT
Ga0184627_1012727223300018079Groundwater SedimentMTPRGRLVIALASTLLVGYVALGSLLGRVLVDTTYGQ
Ga0066662_1174954223300018468Grasslands SoilMSPRGRLVIALVSTLLVGYVAVGSLLGRVLGDTTYGQLAVFNEVVRLVL
Ga0190270_1276415223300018469SoilMSPRGRLFIAILSTAFVGYVAVGSLLNRVIGDTSYTQLAIFNDVTRIVLEAYV
Ga0224500_1022275423300022213SedimentMSQRARLVIALVSTGLIGYIAVGSFLGRVLGDTSYGQLAIFNEVVRLVLDAY
Ga0224505_1040364123300022214SedimentMSHRSRLVIALVSTGLIGYIAVGSLLGKALGDTSYGQL
(restricted) Ga0255046_1031572323300024519SeawaterMSPRVRLLVALVSTGLIGYVAVGSLLARALGDTGYGQLAIFNEVVRLVL
Ga0210139_111035123300025558Natural And Restored WetlandsMAKEGGTIDNCGMSARARLFVALVSTCLVGYIALGSVLGRVLGDTSYSQLTVFNEVVRLV
Ga0210138_104712413300025580Natural And Restored WetlandsMSPRARLVVALASTTLCAYVLLGSVLGRVLGDTTYGQLSVFGEVVRLVLDT
Ga0207645_1017099013300025907Miscanthus RhizosphereMSPRGRLVVALVSTLLVAYVAVGSLLGRVFGDTTYGQLAVFNEVVRLVLDAYV
Ga0207660_1117048623300025917Corn RhizosphereMSPRARLFVAFLSTGFVGYIALGSVLGRVRGDSTYGQLAVFNEVVRIVLDAY
Ga0256867_1016284023300026535SoilMSPRGRLFVALVSTTLVGYVAVGSLLGRVMGDSTYGQLTVFNEVVRLVLEAYVEP
Ga0209253_1002785753300027900Freshwater Lake SedimentMSHRTRLLVALVSTGLIGYIAVGSLLGRVLGDTSYGQLAIFNEVVR
Ga0268265_1192314223300028380Switchgrass RhizosphereMSPRGRLVVALVSTLLVAYVAVGSLLGRVFGDTTYGQLAVF
Ga0302258_115886623300028770FenMSARARLVLALVSTALIGYIAVGSLLGRVLGDTSYGQLAVFNE
Ga0311335_1048077013300030838FenMSPRVRLAVAVVSTALIGYVAVGSLLGRVLGDTSYGQLAIFNE
Ga0311366_1168150623300030943FenMSARARLVLALVSTALIGYIAVGSLLGRVLGDTSYG
(restricted) Ga0255311_106062723300031150Sandy SoilMSPRSRLFIALISTAFVAYVAVGSLLSRVLGDTSYGQLAVFNEVV
Ga0315290_1155105013300031834SedimentMSHRTRLLVAFVSTGLIGYIAVGSLLGRVLGDTSYGQL
Ga0310900_1081919723300031908SoilMSHRSRLLLALASTCLIGYIAVGALLGRALGDTSFGQLAIFNEVVRLVLDA
Ga0310891_1029957123300031913SoilMSHRSRLLLALASTCLIGYIAVGALLGRALGDTSFGQLAIFNEVVRL
Ga0310897_1001943713300032003SoilMSPRGRLVVALVSTLLVAYVAVGSLLGRVFGDTTYGQLA
Ga0315292_1042603023300032143SedimentMSHRTRLLVALVSTGLIGYIAVGSLLGRVLGDTSYGQLAIF
Ga0307470_1149182223300032174Hardwood Forest SoilMSPRARLVVALASTTLCAYVLLGSVLGRVLGDTTYGQLSVFGEVVRLVLDTYVDPVNL
Ga0316192_1121986513300032260Worm BurrowMSPRVRLLVALVSTGLIGYVAVGSLLARALGDTGYGQLAIFNEVV
Ga0335076_1045826013300032955SoilMRLALTYNRGMSPRTRLLVAILSTGLVSYVALGAVLGRALGDTSYTQLSVFNEVIRLVLD
Ga0335084_1114555223300033004SoilMSHRTRLLLALVSTGLIGYIAVGSLLARVMGDTSYGQLAIFNEVVRMVIDS
Ga0316605_1015804013300033408SoilMGHRARLLIALVSTGLIGYVAVGSLLGRVLGDTSYGQLAIFNEVVRLVLDAY
Ga0316603_1036529913300033413SoilMSHRARLLVALVSTGLIGYVAVGSLLGRVLGDTSYGQLAIFN
Ga0316622_10019819933300033416SoilMSHRARLLVALVSTGLIGYVAVGSLLGRVLGDTSYGQLAIFNE
Ga0316622_10133244123300033416SoilMSHRARLLIALVSTGLIGYVSVGSLLGRVLGDTSYGQLAVFNEVV
Ga0316613_1073610913300033434SoilMSHRTRLVVALVSTGLIGYIAVGSFLGRVLGDTSYGQLAIFTEV
Ga0316620_1062383413300033480SoilMSHRTRLVVALVSTGLIGYIAVGSLLGRVLGDTSYGQ
Ga0316627_10086806913300033482SoilMSHRSRLVIALVSTCLVGYIAVGSLLGKVLGDTTYGQLAIF
Ga0316630_1092176723300033487SoilMSARTRLFIALASTCLTAYIALGVLLGRVMGDTTYGQLSVFNEVVRLVIEAYVEPINVDRTL
Ga0299912_1035116023300033489SoilMSHRTRLLVALVSTGLIGYIAVGSFLGRVLGDTSYGQ
Ga0316628_10386066023300033513SoilMSHRTRLVVALVSTGLIGYIAVGSFLGRVLGDTSYGQLAIFTEVVR
Ga0316617_10194628513300033557SoilMSARTRLFIALASTCLTAYIALGVLLGRVMGDTTYGQLSVFNEVVRLVIEAYVEPINVDRTLAG
Ga0373889_058586_1_1473300034052Sediment SlurryMSHRARLLVALVSTGLVGYVAVGSLLGRVLGDTSYGQLAIFNEVVRLVL
Ga0364925_0316729_1_1413300034147SedimentMSPKSRLLVALASTGLIGYVAVGSLLGKALGDTSYGQLAIFNEVVRL
Ga0364934_0089665_2_1513300034178SedimentMSARTRLLIASVSTLLIAYVAVGSLLGRVMGDSTYGQLSIFNEVTHFVRD
Ga0364934_0228905_564_7043300034178SedimentMSHRSRLVIALVSTGLVGYIAVGSLLGKALGDTSYGQLAIFNEVVRL
Ga0364934_0337019_387_5693300034178SedimentMSPRTRLLIALASTCLTAYIAMGTLLGRVFGDTTYGQLAIFNEVVRIVIEAYVEPINLER

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.