NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100484

Metagenome / Metatranscriptome Family F100484

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100484
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 43 residues
Representative Sequence VAAFGTGAGRPLGGRGGSPGFRFTLYALLSVIAMYLDQRAHYL
Number of Associated Samples 91
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 68.63 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 96.08 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.333 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(28.431 % of family members)
Environment Ontology (ENVO) Unclassified
(24.510 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.059 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 33.80%    β-sheet: 0.00%    Coil/Unstructured: 66.20%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF06723MreB_Mbl 93.14
PF02686Glu-tRNAGln 2.94
PF01425Amidase 1.96
PF13177DNA_pol3_delta2 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG1077Cell shape-determining ATPase MreB, actin-like superfamilyCell cycle control, cell division, chromosome partitioning [D] 93.14
COG0721Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunitTranslation, ribosomal structure and biogenesis [J] 2.94
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 1.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.24 %
UnclassifiedrootN/A11.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10744781All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300001867|JGI12627J18819_10048426All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1775Open in IMG/M
3300001867|JGI12627J18819_10398636All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300002245|JGIcombinedJ26739_101396356Not Available593Open in IMG/M
3300002245|JGIcombinedJ26739_101627152All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005184|Ga0066671_10498780All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300005534|Ga0070735_10612277All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300005538|Ga0070731_10811932All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005541|Ga0070733_10339286All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300005542|Ga0070732_10999181All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005577|Ga0068857_101641031All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300005764|Ga0066903_104220932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288769Open in IMG/M
3300005764|Ga0066903_105547819All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300005764|Ga0066903_109048973All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300006034|Ga0066656_10241604All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1159Open in IMG/M
3300006954|Ga0079219_11819857All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300009553|Ga0105249_11707656All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300010048|Ga0126373_12059857All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300010049|Ga0123356_12179975Not Available692Open in IMG/M
3300010359|Ga0126376_10971941All Organisms → cellular organisms → Bacteria → Proteobacteria846Open in IMG/M
3300010371|Ga0134125_11828534All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300010373|Ga0134128_12281893All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300010376|Ga0126381_103378945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288629Open in IMG/M
3300011120|Ga0150983_12708526All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300011120|Ga0150983_13229832All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300011120|Ga0150983_13421176All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300013307|Ga0157372_11287210All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300014658|Ga0181519_10396529Not Available852Open in IMG/M
3300015051|Ga0137414_1003204All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300015054|Ga0137420_1262756Not Available1953Open in IMG/M
3300016404|Ga0182037_10894445All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300016445|Ga0182038_11841445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288547Open in IMG/M
3300017994|Ga0187822_10132718Not Available787Open in IMG/M
3300017999|Ga0187767_10168143Not Available670Open in IMG/M
3300020070|Ga0206356_11133889Not Available686Open in IMG/M
3300020082|Ga0206353_11141286All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300020170|Ga0179594_10291605All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300021178|Ga0210408_11213996All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300021405|Ga0210387_11681690All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300021406|Ga0210386_11268005All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300021444|Ga0213878_10335645Not Available652Open in IMG/M
3300021477|Ga0210398_11501870All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300021478|Ga0210402_10965022Not Available779Open in IMG/M
3300021479|Ga0210410_11698949All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300021560|Ga0126371_10956641All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300023275|Ga0247776_10362332All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300024288|Ga0179589_10204009All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300025711|Ga0207696_1029560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium pilosum1672Open in IMG/M
3300025898|Ga0207692_10255277All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300025912|Ga0207707_10024023All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans5330Open in IMG/M
3300025928|Ga0207700_11684323All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300025928|Ga0207700_11816441All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300026041|Ga0207639_10226116All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1619Open in IMG/M
3300026142|Ga0207698_11296651All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300026322|Ga0209687_1178264All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300026322|Ga0209687_1209603All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300027070|Ga0208365_1029695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288719Open in IMG/M
3300027266|Ga0209215_1033591All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300027546|Ga0208984_1006332All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2151Open in IMG/M
3300027567|Ga0209115_1097123All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300027590|Ga0209116_1053470Not Available874Open in IMG/M
3300027616|Ga0209106_1144074All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300027867|Ga0209167_10257546All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300027869|Ga0209579_10636958All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300027889|Ga0209380_10803330All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300027895|Ga0209624_11067972All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300027986|Ga0209168_10618786All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300030741|Ga0265459_13625261All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300031122|Ga0170822_15206971All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300031231|Ga0170824_124594544All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300031474|Ga0170818_101566450All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300031545|Ga0318541_10539713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288652Open in IMG/M
3300031668|Ga0318542_10134065All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium pilosum1220Open in IMG/M
3300031713|Ga0318496_10405364All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300031715|Ga0307476_10015887All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans4803Open in IMG/M
3300031715|Ga0307476_11298730All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300031723|Ga0318493_10596274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288615Open in IMG/M
3300031769|Ga0318526_10074850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium pilosum1327Open in IMG/M
3300031777|Ga0318543_10549822All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300031793|Ga0318548_10042895All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2038Open in IMG/M
3300031793|Ga0318548_10359535All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300031819|Ga0318568_11029213All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300031823|Ga0307478_10432082All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300031832|Ga0318499_10260523Not Available672Open in IMG/M
3300031859|Ga0318527_10314283Not Available667Open in IMG/M
3300031893|Ga0318536_10542136All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300031941|Ga0310912_10150070All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1758Open in IMG/M
3300031945|Ga0310913_10654419All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300031946|Ga0310910_11392521All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300031959|Ga0318530_10251627All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300032009|Ga0318563_10514982All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300032043|Ga0318556_10154421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium pilosum1185Open in IMG/M
3300032043|Ga0318556_10582075All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300032054|Ga0318570_10277031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288762Open in IMG/M
3300032066|Ga0318514_10118549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium pilosum1355Open in IMG/M
3300032067|Ga0318524_10305622All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300032076|Ga0306924_11943185All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300032174|Ga0307470_11036473All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300032805|Ga0335078_11278931All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300032892|Ga0335081_11129110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288900Open in IMG/M
3300032955|Ga0335076_11279391All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300033805|Ga0314864_0159837All Organisms → cellular organisms → Bacteria576Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil28.43%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil14.71%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil6.86%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.92%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.94%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.96%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.98%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.98%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.98%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.98%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300015051Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300023275Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025711Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027070Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes)EnvironmentalOpen in IMG/M
3300027266Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027546Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027567Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027616Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1074478123300001593Forest SoilVAAFGTGVGRPLGRGGSAGFRFTFFAILSVVAMYLDQRAH
JGI12627J18819_1004842613300001867Forest SoilVTAFGTAAGRPLQGRGGSPGFRFFLYAVFAVVIMYLDQRARYLEHV
JGI12627J18819_1039863623300001867Forest SoilVAAFGTGAGRPLGGRGGSPGFRFTLYALLSVIMMYLD
JGIcombinedJ26739_10139635623300002245Forest SoilVAAFGTVGRPLGRGGSPGFRFTLFAILSVVAMYLDQRQHYLERVRYVLGA
JGIcombinedJ26739_10162715213300002245Forest SoilMAFGTGASSARGGSPGFRFALYAILSIVIMFLDQRW
Ga0066671_1049878023300005184SoilVAAFGTPAGRPWQGRGGSAGFRYTLYAAVAVVVMYLDQRQHYLEQV
Ga0070735_1061227723300005534Surface SoilLAAFGTGARQLQGRGGSPGFRFTIYALLSIVIMFLDERSHWLENAR
Ga0070731_1081193213300005538Surface SoilVAAFGTAAGRPLTGRGGSPGFRFTLYALLAVVVMYLDQRQHYL
Ga0070733_1033928613300005541Surface SoilVAAFGTVPGRPLQGRGGSPGFRFTVYALLSVVGMYLDQR
Ga0070732_1099918113300005542Surface SoilMAAFGTGASRQLSGRGSAPGFRFTIYAALSIVVMFMDKRGEYFERVHYV
Ga0068857_10164103123300005577Corn RhizosphereVAAFGTGASSRSLQGRGGSAGFRFTLYAILSVVVMFLDQRQGW
Ga0066903_10422093213300005764Tropical Forest SoilVAAFGTGAGRPPSGRGGSPGFRFTLYALLSVILMYLDQRAHYLEQ
Ga0066903_10554781913300005764Tropical Forest SoilVAAFGTGAGRPLQGRGGSGFRFTLYALLAVVVMYFDQRGHYLEQVRYALQAAAYPI
Ga0066903_10904897323300005764Tropical Forest SoilVAAFGTGASRQLQGRGGSPGFRFTIYAVLSIVVMFLDERSHWLESARYVLQAAAY
Ga0066656_1024160423300006034SoilVAAFGTAAGRPLQGRDGAAGFRFTVYAALAVVIMYLDQRQHYLERLRYVL
Ga0079219_1181985723300006954Agricultural SoilMAFGTGASSARGGSPGFRFTVYATLSIVIMFLDQRGEYLEQ
Ga0105249_1170765623300009553Switchgrass RhizosphereMAFGTGASSARGGSPGFRFTLYAILSIVIMFLDQKGEYLE
Ga0126373_1205985713300010048Tropical Forest SoilVAAFGTGAGRPLSGRGGSPGFRFTLFAVLSVVIMYLDQRGHYLERV
Ga0123356_1217997513300010049Termite GutVAAFGTGAPRPLPGRGGTGSPGFRFTLYALLSVVVMYLDQRQHYLEQLR
Ga0126376_1097194113300010359Tropical Forest SoilVAAFGTAAGRPLTGRGGSPGFRFTLFALLAVVVMYLDQRQHYLEQVRY
Ga0134125_1182853423300010371Terrestrial SoilVAAFGTGASRQLQGRGGSPGFRFTLYALLSIVVMFLDERSHWLENARYVLQA
Ga0134128_1228189313300010373Terrestrial SoilVAAFGTGAGRPLSGRGGSPGFRFTLYALLSVILMYLDQRAHYLEQL
Ga0126381_10337894513300010376Tropical Forest SoilVAAFGTGAGRPLGGRGGSAGFRFTLYALLSVIMMYLDQR
Ga0150983_1270852613300011120Forest SoilVTAFGTAAGRPLQGRGGSPGFRFTLYGAVAVVIMYLDQRAHYLE
Ga0150983_1322983223300011120Forest SoilVAAFGTGAGRPSGRGGSPGFRFTLFAVLSVITMYLDQRQHYLEQVRYVLQAA
Ga0150983_1342117613300011120Forest SoilVAAFGTAAGRPLGRGGSPGFRFTLYAAVAVVVMYLDQRQHYLEQLRYVLQ
Ga0157372_1128721013300013307Corn RhizosphereLAAFGTGARQLQGRGGSPGFRFFLYALLSIVVMFLDERSHWL
Ga0181519_1039652913300014658BogVAAFGTGAGRPLYGRGGSPGFKFTIYAVLSVVAMYLDQRQHYLEH
Ga0137414_100320423300015051Vadose Zone SoilMAFGTGASSARGGSPGFRFALYAILSIVIMFLDQKG
Ga0137420_126275613300015054Vadose Zone SoilVAAFGTAAGRPLQGRGGAAGFGFRFALYAALAVVVMYLDQRQHYLERVRYVLQA
Ga0182037_1089444513300016404SoilVAAFGTGADRPLGGRGGSPGFRFTLYALLSVIVVYLDQRAHYLEQ
Ga0182038_1184144513300016445SoilVAAFGTGAGRPLGGRGGSPGFRFTLYALLSVIMMYLDQRAHYLEQ
Ga0187822_1013271823300017994Freshwater SedimentVAFGTAAGRPLQGRGGSPGFRFTLYAVLSVVVMYL
Ga0187767_1016814313300017999Tropical PeatlandVTAFGTAASRPLQGRGGSPGFRFTLYAVLAVVVMYLD
Ga0206356_1113388923300020070Corn, Switchgrass And Miscanthus RhizosphereVAAFGTGSRSLQGRGGSAGFRFTLYAVLSVVVMFLDQR
Ga0206353_1114128623300020082Corn, Switchgrass And Miscanthus RhizosphereVAAFGTGARQLQGRGGSPGFRFTLYALLSIVIMFLDERSHWLE
Ga0179594_1029160523300020170Vadose Zone SoilVAAFGTPAGRPWQGRGGSAGLRFTLYAAVAVVVMYLDQRQHYLEQL
Ga0210408_1121399613300021178SoilVAAFGTAASRPLQGRGGSSGFHFTLYATLAVVAMYLD
Ga0210387_1168169013300021405SoilVAAFGTGGSRSVSRGPSPGFRFTLYAILSFVVMFLDQRHGWM
Ga0210386_1126800513300021406SoilVAAFGTAAGRPLQGRGGSPGFRFTLYGAVAVVIMYLDQRAHYLEP
Ga0213878_1033564513300021444Bulk SoilVAAFGTAGGRALGRGSPGFRFTLFALLSVIAMYLDQR
Ga0210398_1150187023300021477SoilVAFGTPGSRSQVRGPSPGFRFTLYAFLSFVIMFLDQRHGW
Ga0210402_1096502213300021478SoilMAFGTGASSARGGSPGFRFTIYAILSIVIMFLDQRGAYL
Ga0210410_1169894923300021479SoilMAFGTGASSARGGSPGFRFAIYAILSIVIMFLDQRGSWLE
Ga0126371_1095664113300021560Tropical Forest SoilVAAFGTGAGRPLGGRGGSAGFRFTLYALLSVIVMYLDQRAHYLEQV
Ga0247776_1036233223300023275Plant LitterMAFGTGASSARGGSPGFRFTLYAIISIVIMFLDQK
Ga0179589_1020400923300024288Vadose Zone SoilMAFGTGASSARGGSPGFQFTLYAILSVVIMFLDQK
Ga0207696_102956013300025711Switchgrass RhizosphereMAFGTGASSARGGSPGFRFTLYAALSIIIMFLDQR
Ga0207692_1025527713300025898Corn, Switchgrass And Miscanthus RhizosphereVAAFGTGASRHLQGRGGSPGFRFFLYALLSMVVMFLDQ
Ga0207707_1002402313300025912Corn RhizosphereVAAFGTGARQLQGRGGSPGFRFTLYALLSIVIMFLDERSHWLENARYF
Ga0207700_1168432323300025928Corn, Switchgrass And Miscanthus RhizosphereVAFGTGAGRPLQGRGGSPGFRFTLYAVLSVVVMYLDQRQHYLE
Ga0207700_1181644123300025928Corn, Switchgrass And Miscanthus RhizosphereVAAFGTGGSRSQVRGPSLGFRFTLYAILSMVVMFLDQ
Ga0207639_1022611633300026041Corn RhizosphereVAAFGTGARQLQGRGGSPGFRFTLYALLSIVIMFLDERSHWLENARYFLQAAAYP
Ga0207698_1129665113300026142Corn RhizosphereVAGFATGAGRPLQGRGGSPGFRFALYAILSIAFMVLDQRFDWLERAHSVMQA
Ga0209687_117826413300026322SoilVAAFGTAAGRPLQGRGGSPGFRFTLYAVLSIVVMFLD
Ga0209687_120960323300026322SoilVAAFGTPAGRPWQARGGSAGFRFTLYAAVAVVVMYLDQRQHY
Ga0208365_102969513300027070Forest SoilVAAFGTAAGRPLGRGGSPGLRFTLYAALAVVAMYLDQRQ
Ga0209215_103359123300027266Forest SoilVAAFGTGAGRPLVGRGGSPGFRFTLYALLSVIVMYLDQRAHYLEQVRYVL
Ga0208984_100633213300027546Forest SoilVAAFGTPAGRPWQGRGGSAGFRFTLYAAVAVVVMYLDQRQHYLEQLRY
Ga0209115_109712313300027567Forest SoilVAFGTPGSRSQVRGPSPGFRFTLYAFLSFVIMFLDQRHGWME
Ga0209116_105347023300027590Forest SoilVAAFGTGVGRPLGRGGSAGFRFTFFAILSVVAMYLD
Ga0209106_114407413300027616Forest SoilVAAFGTPAGRPWQGRGGSAGFRFTLYAAVAVVVMYLDQRQHYLE
Ga0209167_1025754613300027867Surface SoilVAAFGTVPGRPLQGRGGSPGFRFTVYALLSVVAMYLDQRQ
Ga0209579_1063695813300027869Surface SoilVAAFGTAAGRPLTGRGGSPGFRFTLYALLAVVVMYLDQRQH
Ga0209380_1080333023300027889SoilVAAFGTGASRPLQRGGSGFRFTVYAVLAVVCMYFDQRGHYLEQVRYV
Ga0209624_1106797213300027895Forest SoilVAAFGTVGRPLGRGGSPGFRFTLFAILSVVAMYLDQRQHYLER
Ga0209168_1061878613300027986Surface SoilVAGFATGAGRPLEGRRGSPGFRFALYAIVSIAFMILDQR
Ga0265459_1362526113300030741SoilVAAFGTGVGRPLGRGGSAGFRFTFFAILSVVAMYLDQRAHYLEQVRYVLL
Ga0170822_1520697123300031122Forest SoilVAAFGTGGGRPLQARGGSAGFRFTLYAMLAVMVMYLDQR
Ga0170824_12459454413300031231Forest SoilVAAFGTGASRQLQGRGGSLGFRFTLYALLSMVVMFLDERSHWLESSRYVLQAA
Ga0170818_10156645013300031474Forest SoilVAAFGTGASRQLQGRGGSLGFRFTLYALLSMVVMF
Ga0318541_1053971313300031545SoilVAAFGTGAGRPLSGRGGSPGFRFTLYALLSVIAMYLDQRAHY
Ga0318542_1013406513300031668SoilVAAFGTGAGRPLGGRGGSAGFRFTLYALLSVIVMYLDQR
Ga0318496_1040536423300031713SoilVAAFGTGADRPLGGRGGSPGFRFTLYALLSVIVMYLDQRAHYLE
Ga0307476_1001588713300031715Hardwood Forest SoilMAFGTGATSGRGGSPGFRFTLYATVSIIIMFLDQRGEYLE
Ga0307476_1129873013300031715Hardwood Forest SoilMAFGTGASSSRGGSPGFRFALYAILSIVIMFLDQRGNYLEQ
Ga0318493_1059627413300031723SoilVAAFGTGAGRPLGGRGGSAGFRFTLYALLSVIMMY
Ga0318526_1007485013300031769SoilVAAFGTGAGRPLGGRGGSAGFRFTLYALLSVIMMYLDQRAH
Ga0318543_1054982213300031777SoilVAAFGTGADRPLGGRGGSPGFRFTLYALLSVIAMYLDQRA
Ga0318548_1004289543300031793SoilVAAFGTGADRPLGGRGGSPGFRFTLYALLSVIAMYLDQRAHYLEQ
Ga0318548_1035953523300031793SoilVAAFGTGAGRLAGRGGSPGFRFTLYALLSVIVMYLDQRAH
Ga0318568_1102921313300031819SoilVAAFGTGADRPLGGRGGSPGFRFTLYALLSVIAMYLDQRAHY
Ga0307478_1043208223300031823Hardwood Forest SoilVAAFGTAGRPLQGRGGSGFRFTLYALLAVLTMYFDQRGHYLEQVRYVLQAAAYPI
Ga0318499_1026052323300031832SoilVAAFGTGAGRPLGGRGGSPGFRFTLYALLSVIMMYLDQRAHYLEQVR
Ga0318527_1031428313300031859SoilVAAFGTGAGRLAGRGGSPGFRFTLYALLSVIVMYLDQRAHYLE
Ga0318536_1054213613300031893SoilVAAFGTGAGRPLSGRGGSPGFRFTLFAVLSVVIMY
Ga0310912_1015007013300031941SoilVAAFGTGADRPLGGRGGSPGFRFTLYALLSVIAMYLDQ
Ga0310913_1065441923300031945SoilVAAFGTGAGRPLGGRGGSPGFRFTLYALLSVIAMYLDQRAHYL
Ga0310910_1139252123300031946SoilVAAFGTGADRPLGGRSGSPGFRFTLYALLSVIVMYLDQRAHYLEQVRY
Ga0318530_1025162723300031959SoilVAAFGTGADRPLGGRGGSPGFRFTLYALLSVIAMYLDQRAHYLEQVRYVL
Ga0318563_1051498223300032009SoilVAAFGTGAGRPLGGRGGSAGFRFTLYALLSLIVMYLDQRAHYLEQV
Ga0318556_1015442123300032043SoilVAAFGTGADRPLGGRGGSPGFRFTLYALLSVIAMY
Ga0318556_1058207513300032043SoilVAAFGTGAGRPLTGRGGSPGFRFTLYALLSVIVMYLDQRAHY
Ga0318570_1027703123300032054SoilVAAFGTGAGRPLSGRGGSPGFRFTLYALLSVIAMYLDQRAHYLEQVRY
Ga0318514_1011854923300032066SoilVAAFGTGADRPLGGRSGSPGFRFTLYALLSVIVMYLDQRAHYLE
Ga0318524_1030562223300032067SoilVAAFGTGAGRPLTGRGGSPGFRFTLYALLSVVAMYLDQRAHYLEQLRY
Ga0306924_1194318513300032076SoilVAAFGTGADRPLGGRSGSPGFRFTLYALLSVIVMYLDQRAHYLEQVR
Ga0307470_1103647313300032174Hardwood Forest SoilVAAFGTGASRPLYGRGGSGFRFTFYALLSVVAMYLDQRGHYLEQVRYVLQG
Ga0335078_1127893113300032805SoilVAAFGTAAGRPLTGRGGSPGFRFTLYALLSVVVMYLDQRQHYLEQVRY
Ga0335081_1112911013300032892SoilVAAFGTGAGRPLQGRGGSPGFRFTLYAVLSVVIMYLDQRQ
Ga0335076_1127939113300032955SoilMAFGTGASSARGGSPGFRFTLYAIVSIVIMFLDQRGEY
Ga0314864_0159837_2_1303300033805PeatlandMAAFGTAAGRPLQGRGGSPGFRFTLYGVLAVAIMYLDQRAHYL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.