NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100024

Metagenome / Metatranscriptome Family F100024

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100024
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 43 residues
Representative Sequence MELIWLVLSLLVVDLAAFLFAVDTRPGLQHTSRWRGRRRSITG
Number of Associated Samples 79
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 87.38 %
% of genes near scaffold ends (potentially truncated) 18.45 %
% of genes from short scaffolds (< 2000 bps) 82.52 %
Associated GOLD sequencing projects 73
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.641 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(21.359 % of family members)
Environment Ontology (ENVO) Unclassified
(28.155 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(30.097 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 32.39%    β-sheet: 0.00%    Coil/Unstructured: 67.61%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF13560HTH_31 43.69
PF00892EamA 27.18
PF01546Peptidase_M20 6.80
PF13561adh_short_C2 2.91
PF11272DUF3072 2.91
PF01381HTH_3 1.94
PF04107GCS2 1.94
PF00459Inositol_P 1.94
PF00106adh_short 0.97
PF07883Cupin_2 0.97
PF03992ABM 0.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.64 %
UnclassifiedrootN/A21.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c0652520Not Available525Open in IMG/M
3300000550|F24TB_10014311Not Available520Open in IMG/M
3300000550|F24TB_10601476Not Available652Open in IMG/M
3300000891|JGI10214J12806_11870982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1315Open in IMG/M
3300000956|JGI10216J12902_102621188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300001431|F14TB_100656225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300003373|JGI25407J50210_10011361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2275Open in IMG/M
3300003373|JGI25407J50210_10021395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1682Open in IMG/M
3300003373|JGI25407J50210_10090934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria755Open in IMG/M
3300003373|JGI25407J50210_10114005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria667Open in IMG/M
3300004016|Ga0058689_10044596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria806Open in IMG/M
3300004016|Ga0058689_10155905Not Available530Open in IMG/M
3300004157|Ga0062590_101567264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria664Open in IMG/M
3300005562|Ga0058697_10097526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1214Open in IMG/M
3300005562|Ga0058697_10733789Not Available528Open in IMG/M
3300005562|Ga0058697_10796882Not Available510Open in IMG/M
3300005981|Ga0081538_10007532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia9407Open in IMG/M
3300005981|Ga0081538_10049121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2563Open in IMG/M
3300005985|Ga0081539_10038370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2840Open in IMG/M
3300006049|Ga0075417_10001346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae6715Open in IMG/M
3300006844|Ga0075428_100985805Not Available892Open in IMG/M
3300006845|Ga0075421_100256552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2142Open in IMG/M
3300006847|Ga0075431_100614240All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300006852|Ga0075433_10624209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales945Open in IMG/M
3300009789|Ga0126307_10262060All Organisms → cellular organisms → Bacteria1390Open in IMG/M
3300009817|Ga0105062_1066032Not Available680Open in IMG/M
3300009840|Ga0126313_10074306All Organisms → cellular organisms → Bacteria2450Open in IMG/M
3300010038|Ga0126315_10032198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2735Open in IMG/M
3300010038|Ga0126315_10052305All Organisms → cellular organisms → Bacteria2221Open in IMG/M
3300010041|Ga0126312_10159249All Organisms → cellular organisms → Bacteria1569Open in IMG/M
3300010041|Ga0126312_10180471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1472Open in IMG/M
3300010042|Ga0126314_10406558All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300010044|Ga0126310_10698531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria768Open in IMG/M
3300010145|Ga0126321_1344920Not Available521Open in IMG/M
3300010395|Ga0058701_10772188Not Available525Open in IMG/M
3300010999|Ga0138505_100010126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1077Open in IMG/M
3300011000|Ga0138513_100015499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1005Open in IMG/M
3300012939|Ga0162650_100017749All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300012941|Ga0162652_100058368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria640Open in IMG/M
3300014487|Ga0182000_10357944All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300014487|Ga0182000_10537991Not Available551Open in IMG/M
3300014487|Ga0182000_10598675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300015077|Ga0173483_10910459Not Available519Open in IMG/M
3300017965|Ga0190266_10050285All Organisms → cellular organisms → Bacteria1468Open in IMG/M
3300017965|Ga0190266_10167012All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300018027|Ga0184605_10125153All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300018056|Ga0184623_10093579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1387Open in IMG/M
3300018066|Ga0184617_1215274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M
3300018072|Ga0184635_10043081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1729Open in IMG/M
3300018073|Ga0184624_10129614All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300018074|Ga0184640_10073655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1450Open in IMG/M
3300018075|Ga0184632_10018833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2916Open in IMG/M
3300018076|Ga0184609_10002100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6489Open in IMG/M
3300018076|Ga0184609_10089102All Organisms → cellular organisms → Bacteria1373Open in IMG/M
3300018465|Ga0190269_10117144All Organisms → cellular organisms → Bacteria1330Open in IMG/M
3300018466|Ga0190268_10109824All Organisms → cellular organisms → Bacteria1306Open in IMG/M
3300018466|Ga0190268_11867101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300018476|Ga0190274_12034164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium671Open in IMG/M
3300019377|Ga0190264_11009094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium666Open in IMG/M
3300019869|Ga0193705_1091430All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300020005|Ga0193697_1031685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1321Open in IMG/M
3300022756|Ga0222622_10009435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4570Open in IMG/M
3300026670|Ga0208216_102291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria709Open in IMG/M
3300026672|Ga0208214_104138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300027750|Ga0209461_10143676Not Available576Open in IMG/M
3300027750|Ga0209461_10156249Not Available558Open in IMG/M
3300027873|Ga0209814_10000488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria13066Open in IMG/M
3300027907|Ga0207428_10143176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1823Open in IMG/M
3300028589|Ga0247818_10269963All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300028707|Ga0307291_1017693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1598Open in IMG/M
3300028712|Ga0307285_10003942All Organisms → cellular organisms → Bacteria2945Open in IMG/M
3300028720|Ga0307317_10003860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4503Open in IMG/M
3300028720|Ga0307317_10041089All Organisms → cellular organisms → Bacteria1466Open in IMG/M
3300028722|Ga0307319_10043203All Organisms → cellular organisms → Bacteria1409Open in IMG/M
3300028787|Ga0307323_10003941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4812Open in IMG/M
3300028796|Ga0307287_10121656All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300028811|Ga0307292_10004633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4643Open in IMG/M
3300028828|Ga0307312_10276788All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300028878|Ga0307278_10328094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium675Open in IMG/M
3300028880|Ga0307300_10334245Not Available519Open in IMG/M
3300030496|Ga0268240_10183720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300030499|Ga0268259_10048324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium863Open in IMG/M
3300030499|Ga0268259_10057886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria803Open in IMG/M
3300030510|Ga0268243_1089172Not Available707Open in IMG/M
3300030511|Ga0268241_10073604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria762Open in IMG/M
3300030514|Ga0268253_10014431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1824Open in IMG/M
3300030514|Ga0268253_10304542Not Available553Open in IMG/M
3300030516|Ga0268255_10055985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1254Open in IMG/M
3300031091|Ga0308201_10020351All Organisms → cellular organisms → Bacteria1383Open in IMG/M
3300031731|Ga0307405_10262836All Organisms → cellular organisms → Bacteria1290Open in IMG/M
3300031901|Ga0307406_10161680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1610Open in IMG/M
3300031903|Ga0307407_11245438Not Available582Open in IMG/M
3300031995|Ga0307409_100157262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1982Open in IMG/M
3300031995|Ga0307409_101084557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium821Open in IMG/M
3300031995|Ga0307409_101229108Not Available773Open in IMG/M
3300032002|Ga0307416_100714375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1092Open in IMG/M
3300032004|Ga0307414_11186838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium706Open in IMG/M
3300032004|Ga0307414_11272828Not Available682Open in IMG/M
3300032159|Ga0268251_10031115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catenuloplanes → Catenuloplanes japonicus1655Open in IMG/M
3300032159|Ga0268251_10038029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catenuloplanes → Catenuloplanes japonicus1527Open in IMG/M
3300032159|Ga0268251_10600792Not Available506Open in IMG/M
3300034172|Ga0334913_135956Not Available524Open in IMG/M
3300034174|Ga0334932_001195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4069Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.36%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave9.71%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment8.74%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere8.74%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil7.77%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.83%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere5.83%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave5.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil4.85%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.91%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil1.94%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.97%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.97%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.97%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300003373Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300004016Agave microbial communities from Guanajuato, Mexico - As.Ma.rzHost-AssociatedOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009817Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010395Agave microbial communities from Guanajuato, Mexico - Or.Ma.eHost-AssociatedOpen in IMG/M
3300010999Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300012939Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300026670Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1111 (SPAdes)EnvironmentalOpen in IMG/M
3300026672Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1102 (SPAdes)EnvironmentalOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300030499Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300030510Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2)EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300030514Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300030516Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300034172Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMSEnvironmentalOpen in IMG/M
3300034174Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 28HNSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_065252023300000033SoilMELIWLVLTLVVLDLAAFLFAVDTRPGLQHTSRWHPGRRTLTG*
F24TB_1001431123300000550SoilMELIWLVLTLIAVDLAALRFSXDTRPGLQHSSRHRLRRRSATG*
F24TB_1060147623300000550SoilMALFWLVLALLVVDLAAFLFGADTRPGFQHSSHRRANGG*
JGI10214J12806_1187098243300000891SoilMELIWLVLTLVVVDLAAVLFAVDTRPGLQHTSRWHPGRRTLTG*
JGI10216J12902_10262118813300000956SoilPVKNRERSMELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRWHPGRRTLTG*
F14TB_10065622523300001431SoilMELIWLVLTLIAVDLAALRFAADTRPGLQHSSRHRLRRRSATG*
JGI25407J50210_1001136143300003373Tabebuia Heterophylla RhizosphereMELIWLVLVLLAVDLAAFVFAADTRPGLQHTSRWRDRHRATTG*
JGI25407J50210_1002139523300003373Tabebuia Heterophylla RhizosphereMELLWIVLSVVVLDLAAYLFAADSRPGLQHTSHWPTGRRTRTG*
JGI25407J50210_1009093423300003373Tabebuia Heterophylla RhizosphereMELLWFVLILLAVDLAAFRFAADTRPGLEHSAHWPSRRSTRG*
JGI25407J50210_1011400523300003373Tabebuia Heterophylla RhizosphereMELVWLVLTLLAVDLAAVLFAADTRPGLQHTSRWRRRRPSTG*
Ga0058689_1004459623300004016AgaveMELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRRHPGRRTLTG*
Ga0058689_1015590513300004016AgaveMELLWIVLSLIVVDLAAFLFAADTRPGLERTSRWHDRRRSIAG*
Ga0062590_10156726423300004157SoilMELLWLVLSLIVLDLAAFLFAVDTRPGLQHTSRRRDRRPDRPRSATS*
Ga0058697_1009752633300005562AgaveMELLWIVLSLLVVDLAAFLFAADTRPGLEHSSRRRDRRRSIAG*
Ga0058697_1073378913300005562AgaveLVGPVKNRGAIMELLLLVLSLVVVDLAALLFAVDTRPGLQHTSRWHALRRSTTG*
Ga0058697_1079688223300005562AgaveMELLLLVLSLVVVDLAALLFAVDTRPGLQHTSRWHALRRSTTG*
Ga0081538_1000753293300005981Tabebuia Heterophylla RhizosphereMEVIWLVLVLLAVDLAAFLFSADTRPGLQHTPRWRDRHRAATG*
Ga0081538_1004912133300005981Tabebuia Heterophylla RhizosphereMELIWLVLVLLAVDLAAFLFAADTRPGLQHTSRWRDRHRATTG*
Ga0081539_1003837023300005985Tabebuia Heterophylla RhizosphereMELIWIVLTLLVLDLAAFLFAADTRPGLQHTSRWRGR*
Ga0075417_1000134653300006049Populus RhizosphereMELIWLVLSLLVLDLAAFLFAVDTRPGLRHTSRWRDRRRSITG*
Ga0075428_10098580523300006844Populus RhizosphereMELIWLVLSLIVVDLAAFLFAADTRPGLQHTSRWRDRPPSIT
Ga0075421_10025655223300006845Populus RhizosphereMELVWLVLTLIAVDLAALRFAADTRPGLQHSSRHRFRRRSATG*
Ga0075431_10061424013300006847Populus RhizosphereMELVWLVLTLIAVDLAALRFAADTRPGLQHSSRRRFRRRSATG*
Ga0075433_1062420923300006852Populus RhizosphereMELIWLVLSLIVVDLAAFLFAADTRPGLQHTSRWRDRPPSITG*
Ga0126307_1026206023300009789Serpentine SoilMELLWLVLSLIVVDLAAFLFAVDTRPGLQHTSRWRDRRHDRWRSVTG*
Ga0105062_106603223300009817Groundwater SandMGLIWVMLSLLVVDLAALLFAADTRPGLQHSARWWNRRPTS*
Ga0126313_1007430623300009840Serpentine SoilMELLWLVLSLIVVDLAAFLFAVDTRPGLQHTSRWRDRRHDRWRSVTS*
Ga0126315_1003219843300010038Serpentine SoilMELLWLVLSLIVVDLAAFLFAVDTRPGLQHTSRWHDRRHDRRRSVTG*
Ga0126315_1005230523300010038Serpentine SoilMELLWLVLSLLVIDVAAFLFAVDTRPGLEHTSRWRDRRRSIAG*
Ga0126312_1015924913300010041Serpentine SoilSLIVVDLAAFLFAVDTRPGLQHTSRWRDRRHDRWRSVTG*
Ga0126312_1018047113300010041Serpentine SoilMELLWLVLSLIVVDLAAFLFAVDTRPGLQHTSRWRDRRHDRRRSVTG*
Ga0126314_1040655823300010042Serpentine SoilMELIWFVLTLVVVDLAAFLFAVDTRPGLQHTSRRHPGRRTLTG*
Ga0126310_1069853123300010044Serpentine SoilMELLWLVLSLIVVDLAAFLFAVDTRPGLEHTSRWRDRRRSIAG*
Ga0126321_134492023300010145SoilMELIWIVLSLLVLDLAAFLFAADTRPGLQHTSRWHDRRRSITG*
Ga0058701_1077218823300010395AgaveMEVIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRWHPGRRTLTG*
Ga0138505_10001012623300010999SoilMELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRWHPGRRTLTG*
Ga0138513_10001549923300011000SoilMELLWLVLSLIVVDLAAFLFAVDTRPGLQHTSRWRDRRRSVTG*
Ga0162650_10001774913300012939SoilMELVWLVLTLIVVDLAALRFAADTRPGLQHSSRHRLRRRSATG*
Ga0162652_10005836813300012941SoilMELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRWHPGRRTLT
Ga0182000_1035794423300014487SoilMELLWLVLSLLVVDLAAFLFAADTRPGLEHSSRRRDRRRSIAG*
Ga0182000_1053799123300014487SoilMELFWLVLLLVVLDLASFVFAIDSRPGLQHTSRWRSRRSING*
Ga0182000_1059867523300014487SoilMELIWLVLILLVVDLAAFLFAADTRPGLQYSSRRHAPRSHAP
Ga0173483_1091045923300015077SoilMELLWLVLSLIVLDLAAFLFAVDTRPGLQHTSRRRDRRPDRPRSATG*
Ga0190266_1005028523300017965SoilMELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRWHPGRRTLTG
Ga0190266_1016701213300017965SoilMELVWLVLTLIAVDLAALRFAADTRPGLQHSSRLRLRRRSATG
Ga0184605_1012515323300018027Groundwater SedimentMELIWLVLSVLVVDLAAFLFAVDTRPGLQHTSRWRGRRRSITG
Ga0184623_1009357933300018056Groundwater SedimentMGLIWVMLSLLVVDLAALLFAADTRPGLQHSARWWNRRPTS
Ga0184617_121527413300018066Groundwater SedimentMALFWLVLALLVVDLAAFLFGADTRPGFQHSSHRRANGG
Ga0184635_1004308123300018072Groundwater SedimentMELVWLVLTLIAVDLAALRFAADTRPGLQHSSRRRLRRRSATG
Ga0184624_1012961413300018073Groundwater SedimentMELVWLVLTLIAVDLAALRFAADTRPGLQHSSRRLRRRSATG
Ga0184640_1007365533300018074Groundwater SedimentMELLWLVLSLLAVDLAALLFAADTRPGLQHSSRHRLRRRSATG
Ga0184632_1001883313300018075Groundwater SedimentMELVWLVLTLIAVDLAALRFAADTRPGLQHSSRHRFRRRSATG
Ga0184609_1000210013300018076Groundwater SedimentMELIWVMLSLLVVDLAALLFAADTRPGLQHSARWWNRRPTS
Ga0184609_1008910233300018076Groundwater SedimentMGLIWVMLSLLVVDVAALLFAADTRPGLQHSARWWNRRPTS
Ga0190269_1011714413300018465SoilMELVWLVLTLIVVDVAALRFAADTRPGFQHSSRRLRRRSATG
Ga0190268_1010982423300018466SoilMELVWLVLTLIVVDLAALRFAADTRPGLQHSSRHRLRRRSATG
Ga0190268_1186710123300018466SoilMELLWLVLSLIVVDLAAFRFAADSRPGLQHSSRHRLRRRSATG
Ga0190274_1203416413300018476SoilMELIWLVLTLVAVDLAAFLFAADTRPGLQHSSRLRLRRRSATG
Ga0190264_1100909423300019377SoilMELLWLTIALIVVVDLAAVLFAADTRPGLEHSARWWNRR
Ga0193705_109143023300019869SoilMELIWLVLSLLVVDLAAFLFAVDTRPGLQHTSRWRGRRRSIPG
Ga0193697_103168523300020005SoilMELLWLVLSLLAVDLAALLFAADTRPGLQHSSRHRFRRRSATG
Ga0222622_1000943553300022756Groundwater SedimentMELIWLVLSVLVVDLAAFLFAVDTRPGLQHTSRWRGRRRSIPG
Ga0208216_10229123300026670SoilMELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRRHPGRRTLTG
Ga0208214_10413823300026672SoilGPVKNRERSMELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRWHPGRRTLTG
Ga0209461_1014367623300027750AgaveMVLLWLVLSLIVLDLAPLVFAVDTRPGLRHTSRWHDGRRWPDRRRSLTG
Ga0209461_1015624923300027750AgaveMELLWIVLSLLVVDLTAILFAVDTRPGLEHSSRWRDRRRSIAG
Ga0209814_1000048893300027873Populus RhizosphereMELIWLVLSLLVLDLAAFLFAVDTRPGLRHTSRWRDRRRSITG
Ga0207428_1014317623300027907Populus RhizosphereMELIWLVLSLIVVDLAAFLFAADTRPGLQHTSRWRDRPPSITG
Ga0247818_1026996313300028589SoilMELVWLVLTLIAVDLAALRFAADTRPGLQHSSRRRFRRRSATG
Ga0307291_101769343300028707SoilMELIWLVLSLLVVDLAAFLFAVDTRPGLQHTSRWRGRRRSITG
Ga0307285_1000394233300028712SoilMELIWLVLSLLVLDLAAFLFAVDTRPGLQHTSRWRGRRRSITG
Ga0307317_1000386013300028720SoilVLSVLVLDLAAFLFAVDTRPGLQHTSRWRGRRRSITG
Ga0307317_1004108913300028720SoilLTLIAVDLAALRFAADTRPGLQHSSRHRFRRRSATG
Ga0307319_1004320313300028722SoilMELVWLVLTLIAVDLAALRFAADTRPGLQHSSRHRLRRRSATG
Ga0307323_1000394113300028787SoilRTRERPMELIRLVLSVLVVDLAAFLFAVDTRPGLQHTSRWRGRRRSITG
Ga0307287_1012165613300028796SoilMELIWLVLSVLVLDLAAFLFAVDTRPGLQHTSRWRGRRRSITG
Ga0307292_1000463313300028811SoilMELIWLVLSVLVLDLAAFLFAVDTRPGLQHTSRWRGRRRSIPG
Ga0307312_1027678833300028828SoilMELIWLVLSLLVVDLAAFLFAVDTRPGLQHTSRWRGRRR
Ga0307278_1032809413300028878SoilWEPPMGLIWVMLSLLVVDLAALLFAADTRPGLQHSARWWNRRPTS
Ga0307300_1033424523300028880SoilMELMWLVLSVLVVDLAAFLFAVDTRPGLQHTSRWRGRRRSITG
Ga0268240_1018372013300030496SoilMELLWLVLSLLVVDLAAFLFAVDTRPGLQHTSRWHDRRRSTAG
Ga0268259_1004832413300030499AgaveGPVKNRERSMELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRRHPGRRTLTG
Ga0268259_1005788613300030499AgaveMELFWLVLLLVVLDLASFVFAIDTRPGLQHTSRWRGRRSIAG
Ga0268243_108917223300030510SoilMELLLLVLSLVVVDLAALLFAVDTRPGLQHTSRWHALRRSTTG
Ga0268241_1007360423300030511SoilMELLWIVLSVIVVDLAAFLFAADTRPGLERTSRWHDRRRSITG
Ga0268253_1001443143300030514AgaveMELLWIVLSLIVVDLAAFLFAADTRPGLERTSRWHDRRRSLTG
Ga0268253_1030454223300030514AgaveTGTSLVGPVKNRERSMELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRWHPGRRTLTG
Ga0268255_1005598523300030516AgaveMEVLWIVLSLIVVDLAAFLFAVDTRPGLEHSSRWRDRRRSIAG
Ga0308201_1002035123300031091SoilMELIWLVLSLLVVDLAAFLFAVDTRPGLQHTSRWRCRRRSITG
Ga0307405_1026283623300031731RhizosphereMELLWLVLSLIVVDLAAFLFAVDTRPGLQHTSRWRDRRHDRWRSVTG
Ga0307406_1016168033300031901RhizosphereMELLWLVLSLIVVDLAAFLFAVDTRPGLQHTSRWRDRRHDRRRSVTG
Ga0307407_1124543823300031903RhizosphereMELLWLVISLLVVDLAAFLFAVDTRPGLEHTSRWRDRRRSIAG
Ga0307409_10015726213300031995RhizosphereMELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRRH
Ga0307409_10108455723300031995RhizosphereLVGPAKNRERSMELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRRHPGRRTLTG
Ga0307409_10122910813300031995RhizosphereSLIVVDLAAFLFAVDTRPGLQHTSRWRDRRHSVTG
Ga0307416_10071437513300032002RhizosphereMELLWLVLSLIVVDLAAFLFAVDTRPGLQHTSRWRDRRH
Ga0307414_1118683813300032004RhizosphereHCTGTSLVGPVKNRERSMELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRWHPGRRTLTG
Ga0307414_1127282813300032004RhizosphereMELLWLVLSLIVVDLAAFLFAVDTRPGLQHTSRWHDRRHDRWRSVTG
Ga0268251_1003111523300032159AgaveMELFWLVLLLVVLDLASFVFAIDTRPGLQHTSRWRSRRSITG
Ga0268251_1003802943300032159AgaveMELLWIVLSLLVVDLAAFLFAADTRPGLEHSSRRRDRRRSIAG
Ga0268251_1060079223300032159AgaveMELFWLVLLLVVLDLASFVFAIDTRPGLQHTSRWGGRRSIAG
Ga0334913_135956_293_4213300034172Sub-Biocrust SoilMELFWLVLLLVVLDLASFVFAIDTRPGLQHTSRWRTRRSITG
Ga0334932_001195_386_5173300034174Sub-Biocrust SoilMELFWIVLSVVVLDLAACLFAADSRPGLQHTSRWPTGRRTRTG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.